KEGG   Candida albicans: CaO19.8100Help
Entry
CaO19.8100        CDS       T00189                                 

Gene name
HST7
Definition
likely MAP kinase kinase that can functionally substitute for S. cerevisiae STE7 (YDL159W)
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cal  Candida albicans
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cal04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 589 aa AA seqDB search
MTRTTRIDTQEATKHKDLPPVPSPLSLSSNPNPECLMESKSLGRKNFKKLSLDASPVKST
SGSLRSSDMMSIKEPTSLRQKRQRPPPILHLPTASSSATSTPTSNITGSSSASSIQFAQK
SPGSGVIVSQTLSRPSSAGGIPSSGYSSLNVNQSNRNVDPDNVVSTDMILNQISNLDLTS
MNHHRQHYQNSHHHLPTTNRKRQTVISSISPTKSSAASSPLEPQIQSLPASSQSPIATTS
ALKLNNKDLLTLKQLGSGNSGSVSKILHIPTQKTMAKKIIHIDSKSVIQTQIIRELRILH
ECHSPYIIEFYGACLNNNNTIVICMEYCNCGSLDKILPLCENKQFPTFVLKKLSFAILSG
LTYLYTTHKIIHRDIKPNNVLMTHKGEFKLCDFGVSRELTNSLVMADTFVGTSMYMSPER
IQGLDYGVKSDVWSTGLMLIELASGVPVWSEDDNNNDDDEDDEDDAYVRQGSIAAERNGQ
NSPSRSRKNKQKGNGYNSYNGPEGILDLLQRIVNEDAPTLTNKINPVTKLPYDKYLCQFI
DLCLIKDDSVRKTPWQLLEDKEHFFKGVEEGVYDKEHKSWAKKIRKCKV
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaacaactcgtatagatacacaagaagctacaaagcataaggatttaccacca
gtgccttcaccattatcattatcatcgaatccaaatccagaatgcctaatggaatccaaa
agtctaggtaggaagaacttcaaaaagctttcactagatgcatctccagtcaaatcaaca
agcggtagcctaaggagttctgatatgatgctgataaaggagccgacttctttacgacaa
aagagacaacgcccgccacctatacttcatttacccactgcatcttcatctgctacgtcc
actccaacatccaatataacagggtcttcatcagcttcttctatacaatttgcacagaaa
tcccctgggtcaggtgtaattgtgagtcaaacattgagccgaccttcaagtgccggaggc
attccatcttcaggttactcttcattgaacgtcaatcaaagcaataggaatgttgatcca
gataatgtggtttccaccgatatgatattaaaccaaatatccaatttagatttaacaagt
atgaaccatcatcgccagcattatcaaaatagccatcaccatcttccaacaaccaatcgt
aaacgtcaaactgtcatttcctcaatatcaccaacaaaatcatcagcagcatcatctccg
ttggaaccacaaattcaactgttgccagcttcatcgcagtctcctattgccactaccagt
gcattaaagttaaacaataaagatttgttgacgttaaaacagttgggatcaggaaactca
ggatcggtgctgaaaatcttacacatccccacccaaaaaacaatggcgaagaaaatcatt
catattgatctgaaaagtgtgatacaaactcaaatcatccgtgaattgagaatactacat
gaatgccattctccttatatcattgagttttatggagcttgtttgaacaataacaacacg
attgttatttgtatggaatattgtaattgtggatcattagataagatattgcccctttgt
gaaaataaacaattccctacttttgttttgaagaaattatcgtttgccattttatctggg
ttgacttatttatataccactcataaaatcattcatcgtgacatcaaaccaaataacgtg
ttaatgactcataaaggggagtttaaattgtgtgattttggtgtatctcgagaattgacc
aattcattggtcatggccgacacttttgtcggtacttctatgtacatgtctccagaaaga
attcaagggttggactacggagtcaagtcagatgtctggtcaacaggattaatgttgata
gaacttgccagtggcgtgccagtatggtcggaggatgataacaataatgacgacgatgag
gatgacgaagacgatgcctatgttaggcaaggatctatagcagcagaaagaaacgggcaa
aatagtccaagcagaagcagaaagaataaacaaaaaggaaatggttacaattcatataat
ggaccagaaggtatattagatctattacaaagaatagtcaatgaagatgcccctacattg
acaaacaaaatcaatcctgtgacaaagttgccatatgacaaatatttgtgtcaatttatt
gatttgtgtttgattaaagatgattcagtacgaaagactccttggcaattacttgaagac
aaagaacattttttcaaaggggtcgaagaaggtgtttatgacaaagaacacaagagctgg
gcgaaaaagatcagaaaatgcaaagtgtaa

DBGET integrated database retrieval system