KEGG   Candida albicans: CaO19.8210Help
Entry
CaO19.8210        CDS       T00189                                 

Gene name
FOL1
Definition
(RefSeq) likely pterin binding enzyme similar to S. cerevisiae FOL1 (YNL256W) involved in folic acid and derivative biosynthesis
  KO
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
cal  Candida albicans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CaO19.8210 (FOL1)
Enzymes [BR:cal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CaO19.8210 (FOL1)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CaO19.8210 (FOL1)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     CaO19.8210 (FOL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 788 aa AA seqDB search
MLKNDTVFTKDISCTAITGKDAWNRPTPQPITISLSFSTDFQKASELDNLKCSINYAVIT
RNVTEFMKSNEHLNFKSLGNIAQAISDIGLDQSRGGGSIVDVTIKSLKSEIRAESVEYKI
NRNTLGQPVPLDIFQVNKLRLLTIIGVFTFERLQKQIVDVDLQFKIAPNSNLYFHQIIAD
IVSYVESSNFKTVEALVSKIGQLTFQKYDGVAEVVATVTKPNAFSHVEGVGVSSTMVKDN
FKDMEPVKFENTIAQTNRAFNLPVENEKTEDYTGYHTAFIAFGSNTGNQVENITNSFELL
QKYGITIEATSSLYISKPMYYLDQPDFFNGVIKVNFQNISPFQLLKILKDIEYKHLERKK
DFDNGPRSIDLDIILYDDLQLNTENLIIPHKSMLERTFVLQPLCEVLPPDYIHPISAESL
HSHLQQLINDKPQETVQESSDLLQFIPVSRLPVKDNILKFDQINHKSPTLIMGILNMTPD
SFSDGGKHFGKELDNIVKQAEKLVSEGATIIDIGGVSTRPGSVEPTEEEELERVIPLIRA
IRQSSNPDLSKVLISVDTYRSNVAEQSLLVGADIINDISMGKYDEKIFDVAAKYGCPYIM
NHTRGSPKTMSKLTNYESNTNDDIIEYIIDPKLGHQELDLSPEIKNLLNGISRELSLQMF
KAMAKGVKKWQIILDPGIGFAKNLNQNLAVIRNASFFKKYSIQINERVDDVTIKHKYLSF
NGACVLVGTSRKKFLGTLTGNDVPSDRVFGTGATVSACIEQNTDIVRVHDVKEMKDVVCI
SDAIYKNV
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaacgataccgttttcactaaagatatttcttgtacggcgataactggtaaa
gatgcctggaatcgaccaacaccacaaccaatcactatatcattatctttcagtactgat
ttccagaaggcatcggaattggataatttgaaatgctcaattaattatgctgttattacc
agaaatgtaactgaatttatgaaatcaaatgagcatttaaatttcaagtcattaggaaat
attgctcaagcaattagtgatattggattagatcaatctagaggtggtggatctattgtg
gatgtgacgataaaaagtttgaaatcagaaataagagctgaaagtgtcgaatataaaatt
aatagaaacactttgggtcaacccgttccattagatattttccaagttaataaattgaga
ttattgacaattattggggttttcacatttgaaagattacaaaaacaaatagttgatgtt
gatttacaatttaaaattgcacctaattccaatttatatttccatcaaataattgctgat
attgtttcatacgtggaatcatctaatttcaaaactgtagaagcattggtgtctaagatt
ggtcaattgacatttcagaaatatgacggagtagctgaagttgttgctactgtcactaaa
ccgaatgcattcagtcatgttgaaggtgttggggtatcatctaccatggtcaaagacaat
ttcaaagatatggaaccagttaaatttgaaaacacaattgctcaaactaatagagcattc
aatttacctgttgaaaatgagaaaactgaggattataccgggtaccacactgcatttatt
gcctttggatccaatactggaaatcaagtagaaaatattaccaattcattcgaattgttg
caaaaatatggaatcaccatagaagcaacttcatcattgtacatttctaaaccaatgtat
tacttggatcaaccagattttttcaatggagtaattaaagtgaatttccaaaacatttca
cctttccagttgttgaaaattctaaaagatattgaatataaacatttagaaaggaaaaaa
gactttgataatgggcccagatcaatagatttggatattatactatatgacgatttacaa
ttaaataccgagaatctaattattccacataaatcaatgttagaaagaacatttgtatta
caaccattatgtgaagtattaccccctgattatattcatcccatcagtgcagaaagtttg
catagccatttacaacaattaataaatgataaacctcaagagacagtacaagaatcgtct
gatttattacaatttatcccagtctctagattacctgtcaaagataatattttgaaattt
gatcaaattaatcataaatctcctactttgattatgggtatattgaatatgactcctgat
tcatttagtgatggtgggaaacattttggaaaagaactagataatattgtgaagcaggca
gagaaattagtcagtgagggtgctacgattattgacattggaggagtttccacacgacca
ggaagtgttgaacccactgaggaagaagaattggaacgtgtgattccattaattagagcc
attcgtcaatcactgaaccctgatttactgaaggtgttgatttcggttgatacttatcgt
agtaacgttgctgaacaaagtttacttgtgggtgctgacataatcaacgatatctcaatg
ggcaaatatgatgaaaaaatatttgatgtggctgccaaatatggatgtccttatatcatg
aatcatactcgaggatcacctaaaaccatgtctaaattgaccaattatgaatcaaataca
aatgatgatattatcgaatatataattgatcctaaattaggacatcaagaattggatttg
tcacctgaaatcaagaatttactcaatggaatcagtcgtgaattgagtttacaaatgttt
aaagccatggctaaaggagtgaaaaaatggcaaattattttggatccaggtattggattt
gctaaaaatttgaatcaaaatttagcagttattcgtaatgcctcgttttttaaaaaatat
tctattcaaattaatgaacgtgttgatgatgtaacaatcaaacataaatatttaagtttt
aatggtgcttgtgttttggtggggacatcaagaaagaagtttttggggacattaactggt
aatgacgtgcctctggatcgagtatttggcactggtgcaacagtgtctgcgtgtattgaa
caaaacactgatattgtaagagttcatgatgttaaagaaatgaaagatgtagtatgtata
agtgatgcaatttataaaaatgtataa

DBGET integrated database retrieval system