KEGG   Candida albicans: CaO19.8324Help
Entry
CaO19.8324        CDS       T00189                                 

Gene name
GCN5
Definition
bromodomain protein similar to S. cerevisiae GCN5 (YGR252W) histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CaO19.8324 (GCN5)
Transcription machinery [BR:cal03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CaO19.8324 (GCN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 449 aa AA seqDB search
MVDRKRTAAIRAEDDDEENDNVPLQKKVKIEAKQKEEEEDGDKSGATETKSEVKQESKEE
TTQKENNEEDEEEEEEEDDEEAEEEKKRITNFNFDGEIYTFKERPSVIEEKEGKIEFRVV
NNDNSRENLIVLTGLKNIFQKQLPKMPREYISRLVYDRSHLSMAVVRKPLTVVGGITYRP
FNNRGFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRATSPIKYFLTYADNYAIGYFKKQG
FTKEISLDKSVWMGYIKDYEGGTLMQCSMLPSILRYLDSGKILLLQKAAIERKIRSRSKS
KIVRPGLQVFKTNKNVTLDPKDIPGLAEAGWSEEMDKLAQKPKRGPHYNFMVTLFSEIQN
HPSAWPFAVAVNKEEVPDYYRVIEHPIDLATIEQKLENNLYLKFTDFVDDLKLMFNNCRA
YNSETTTYYKNANKLEKFMNNKLKDCSFV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggttgacagaaaaagaactgcagcaatacgtgccgaggatgatgatgaagaaaatgac
aatgttcctttacagaaaaaagtgaaaatagaagcaaagcagaaagaagaagaggaagat
ggtgataagtcaggagccacggaaaccaaatctgaggtgaaacaagaatcaaaagaagaa
actactcaaaaggaaaataatgaagaggacgaggaagaggaagaagaggaagatgacgaa
gaagccgaagaagagaagaaaagaataaccaatttcaattttgatggcgaaatttacaca
ttcaaggaaagaccttcggtaattgaagaaaaagaaggcaaaatagagtttcgtgtggtg
aataatgacaatagtcgagaaaacttgattgtgctaaccgggttaaagaatattttccaa
aagcaactacccaagatgcctcgtgaatatatctcgcgtttggtgtatgatcgatcacat
ttgtcaatggcagttgtgagaaagccattaactgtggtaggtgggatcacataccgtcca
tttaacaaccgtggatttgccgaaattgtgttttgtgctatctcgtcaactgaacaagtg
cgtgggtatggtgcacatttgatgaatcatttgaaagactatgtgagggcaacatctcca
atcaaatatttcttgacgtatgcagataactatgctattgggtatttcaaaaagcagggt
ttcacgaaggaaatatcattagataaatcggtgtggatggggtacatcaaggattacgaa
ggtggtacattgatgcagtgctcgatgttaccgtcaatattaaggtaccttgatctgggt
aaaatattacttttgcaaaaagctgctattgaaagaaaaatacggtctagatctaaatca
aaaatagtgagaccgggtttgcaagtttttaaaaccaataagaatgtgacattagacccc
aaagatatccctggattagcagaggcagggtggctggaagaaatggataaattagcacaa
aaaccgaaaagaggaccacattataactttatggttacgctattcagtgaaattcagaac
cacccttctgcttggccatttgcagtggcagtcaacaaagaagaagtaccagattattat
cgagttattgaacatccaattgatttggcaacaatagaacaaaaattggaaaacaacttg
tatttaaaatttactgattttgtggatgatctaaaactaatgttcaacaattgtcgagct
tataattcggaaaccacaacatattataaaaacgcaaataaactagaaaagtttatgaat
aataaattgaaagactgtagttttgtatag

DBGET integrated database retrieval system