KEGG   Candida albicans: CaO19.8517Help
Entry
CaO19.8517        CDS       T00189                                 

Gene name
HEM2
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cal  Candida albicans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cal00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 341 aa AA seqDB search
MVHQAEFLPSTGNSISSVLQGGYNHPLSREWQQERQLTKNMFIFPLFITDSPDEETAIPT
LPNIKRFGVNKLIPYVKNLVEKGLRAVILFGVPLKPGVKDALGTAADDPEGPVITAIKKL
RENFPDLFIMCDVCLCEYTDHGHCGILNEDGSLIREESVQRIAAVAVNYAKAGANSVAPS
DMMDGRIKDIKTGLMNAGLANKCLVMSYAAKFSGNLYGPFRDAAGSAPSHGDRKAYQLPP
GGAGLARRALMRDMSEGADAVIVKPSTFYLDIVSDAAKLCRDYPICAYHVSGEYAMLHAA
ADKGVVDLKGIAFEAHQGFLRAGARLIISYFTPEFLEWLQV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtccatcaagctgaatttttaccttctacaggtaattctatatcatctgtcttacaa
ggtggatataatcatccattgtctagggaatggcaacaggaaagacaattgaccaaaaat
atgttcattttcccattgtttattactgattcaccagatgaagaaactgcgatccccaca
ttgccaaacatcaagcgttttggtgtaaataaattgattccctatgtgaaaaacttggtt
gaaaaagggttgagagctgtgatattgtttggagttccattgaagccaggtgtcaaggat
gcattgggtacagctgcagatgatcctgaaggaccagttattaccgcgatcaaaaaatta
cgtgaaaatttccctgatttatttatcatgtgtgatgtttgtctttgtgaatacacagat
catggacactgtgggatattgaatgaagatggatcattgataagagaggaatcagtacaa
agaattgccgcagtggcggtcaactatgcaaaagcaggtgcaaactctgttgctccttca
gatatgatggatggacgtatcaaagatatcaagaccgggttaatgaatgctggtttagcc
aacaagtgtttggtcatgtcgtatgcggccaaattctctggcaacttgtatggaccattt
cgtgacgctgctggaagtgcaccaagtcatggagatagaaaagcataccaattaccacca
ggaggtgctggtttggcacgtcgtgctttgatgagagacatgagtgaaggtgctgatgca
gttattgtgaaaccaagtaccttctacttggatattgttagtgatgcagccaaattatgc
cgtgattatccaatatgtgcataccatgttagtggagaatatgccatgttgcatgcagca
gccgataaaggagttgttgatttaaagggaattgcatttgaagcccatcaaggattttta
cgagcaggggcaagattaattattagttatttcaccccagagtttttagaatggttgcaa
gtatga

DBGET integrated database retrieval system