KEGG   Candida albicans: CaO19.8599Help
Entry
CaO19.8599        CDS       T00189                                 

Gene name
PHO8
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cal  Candida albicans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CaO19.8599 (PHO8)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CaO19.8599 (PHO8)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CaO19.8599 (PHO8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 502 aa AA seqDB search
MAFIFPKLLNLTTLALAVYLYLFTTVDAAPVDNSKPKKKNIILLIGDGFGPSGVTLARHY
KQVKNNLSPRDLLFMDSFLIGAQRTSSNSSFITDSAAAGTALATGHKTINGQISVDVNKK
PVGAIGEALKLLGYTVGLVVTTSVGDATPCVWVSHAESRSDQDLIVEQMVGQTHPMGPVA
DLIIGGGRDWFIGLDQGGKRRDNRSLIEEVQKNGTWTYVGDRAGFDSLDKGKNASLPLLG
LFAKDNYPYRIDRKDSEYPNLVEQTQVALNALTEHTKDNDKGFFLMVESSRIDHSGHENC
VQAHAQEALEYDQVINLVHNYTKNADIDTVVVATADHETGGLVLNQKTPNDFKVVFNATH
SGEYLAKQILTYKEQDKLADFVKETVIEQGLGLTNYTDEEVTRLVNIAQKNSTTTATTLG
VAIANLTSSRAKAYWGSLDHTSVDVDLYAFSNADYLQQKVTNVREGLAGFHENTDFSVFI
KSIEDIDLDKATELVANVRTKY
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcttttatctttccaaaattattaaaccttaccacattggctttggccgtatactta
tacttgttcaccactgttgatgctgctcctgttgataactctaaacctaaaaagaaaaac
attattttgttaataggtgatgggtttggtccaagtggtgtcactttagctcgtcattat
aaacaagttaaaaacaacttgtccccaagagatcttttattcatggactcattcttgatt
ggtgcccaaagaacatcatccaattcatcttttattactgattctgctgctgctggtact
gcattagccactggtcacaaaaccatcaatggtcaaatctcagttgatgtcaataagaaa
ccagtgggtgctattggtgaagctcttaaattgttgggttacaccgttggacttgttgtc
actacttcagttggtgatgctactccatgtgtttgggtcagtcacgctgaatcaagatcc
gaccaagatcttattgttgaacaaatggttggtcaaactcacccaatgggtccagtcgct
gatttgattattggtggtggtagagactggtttattggtcttgaccaaggtggtaaaaga
agagataatagaagtttgattgaagaagtccaaaagaatggtacttggacatatgttggt
gacagagctggttttgacagtttggacaagggtaagaatgcttctttaccattattaggt
ttatttgccaaagacaactatccatacagaattgaccgtaaagattctgaatatcccaac
ttggttgaacaaactcaggtagctttaaatgctttaactgaacacaccaaggataatgat
aaaggtttctttttgatggttgaaagttccagaattgatcattctggtcacgaaaattgt
gttcaagcccatgctcaagaagcccttgaatacgatcaagttattaacttggttcacaac
tataccaagaatgccgatatcgataccgttgttgttgccacagctgatcacgaaactggt
ggtcttgttcttaaccaaaaaacaccaaatgatttcaaagttgtttttaatgctactcat
tctggtgagtacttagctaaacaaatcttgacttataaagaacaagacaaattagctgat
tttgtcaaagaaactgttattgaacaaggtttgggattgaccaactacactgacgaagaa
gttactagactcgttaatattgctcaaaagaactctactactactgccaccactcttggt
gttgctattgccaacttgacttcctcaagagccaaagcttactggggatctcttgaccac
acttcagttgacgttgatttgtacgctttttccaatgctgattatcttcaacaaaaagtt
actaatgttagggaaggattggctggtttccacgaaaacactgatttcagtgtctttatc
aagtcaattgaagatattgatttagacaaagctactgaattagttgccaatgtcagaact
aaatattaa

DBGET integrated database retrieval system