KEGG   Candida albicans: CaO19.8599Help
Entry
CaO19.8599        CDS       T00189                                 

Gene name
PHO8
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cal  Candida albicans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cal00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 502 aa AA seqDB search
MAFIFPKLLNLTTLALAVYLYLFTTVDAAPVDNSKPKKKNIILLIGDGFGPSGVTLARHY
KQVKNNLSPRDLLFMDSFLIGAQRTSSNSSFITDSAAAGTALATGHKTINGQISVDVNKK
PVGAIGEALKLLGYTVGLVVTTSVGDATPCVWVSHAESRSDQDLIVEQMVGQTHPMGPVA
DLIIGGGRDWFIGLDQGGKRRDNRSLIEEVQKNGTWTYVGDRAGFDSLDKGKNASLPLLG
LFAKDNYPYRIDRKDSEYPNLVEQTQVALNALTEHTKDNDKGFFLMVESSRIDHSGHENC
VQAHAQEALEYDQVINLVHNYTKNADIDTVVVATADHETGGLVLNQKTPNDFKVVFNATH
SGEYLAKQILTYKEQDKLADFVKETVIEQGLGLTNYTDEEVTRLVNIAQKNSTTTATTLG
VAIANLTSSRAKAYWGSLDHTSVDVDLYAFSNADYLQQKVTNVREGLAGFHENTDFSVFI
KSIEDIDLDKATELVANVRTKY
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcttttatctttccaaaattattaaaccttaccacattggctttggccgtatactta
tacttgttcaccactgttgatgctgctcctgttgataactctaaacctaaaaagaaaaac
attattttgttaataggtgatgggtttggtccaagtggtgtcactttagctcgtcattat
aaacaagttaaaaacaacttgtccccaagagatcttttattcatggactcattcttgatt
ggtgcccaaagaacatcatccaattcatcttttattactgattctgctgctgctggtact
gcattagccactggtcacaaaaccatcaatggtcaaatctcagttgatgtcaataagaaa
ccagtgggtgctattggtgaagctcttaaattgttgggttacaccgttggacttgttgtc
actacttcagttggtgatgctactccatgtgtttgggtcagtcacgctgaatcaagatcc
gaccaagatcttattgttgaacaaatggttggtcaaactcacccaatgggtccagtcgct
gatttgattattggtggtggtagagactggtttattggtcttgaccaaggtggtaaaaga
agagataatagaagtttgattgaagaagtccaaaagaatggtacttggacatatgttggt
gacagagctggttttgacagtttggacaagggtaagaatgcttctttaccattattaggt
ttatttgccaaagacaactatccatacagaattgaccgtaaagattctgaatatcccaac
ttggttgaacaaactcaggtagctttaaatgctttaactgaacacaccaaggataatgat
aaaggtttctttttgatggttgaaagttccagaattgatcattctggtcacgaaaattgt
gttcaagcccatgctcaagaagcccttgaatacgatcaagttattaacttggttcacaac
tataccaagaatgccgatatcgataccgttgttgttgccacagctgatcacgaaactggt
ggtcttgttcttaaccaaaaaacaccaaatgatttcaaagttgtttttaatgctactcat
tctggtgagtacttagctaaacaaatcttgacttataaagaacaagacaaattagctgat
tttgtcaaagaaactgttattgaacaaggtttgggattgaccaactacactgacgaagaa
gttactagactcgttaatattgctcaaaagaactctactactactgccaccactcttggt
gttgctattgccaacttgacttcctcaagagccaaagcttactggggatctcttgaccac
acttcagttgacgttgatttgtacgctttttccaatgctgattatcttcaacaaaaagtt
actaatgttagggaaggattggctggtttccacgaaaacactgatttcagtgtctttatc
aagtcaattgaagatattgatttagacaaagctactgaattagttgccaatgtcagaact
aaatattaa

DBGET integrated database retrieval system