KEGG   Candida albicans: CaO19.86Help
Entry
CaO19.86          CDS       T00189                                 

Gene name
GPS2
Definition
one of four potential glutathione peroxidase genes; second of a repeat of three genes similar to S. cerevisiae HYR1 (YIR037W) thiol peroxidase/hydroperoxide sensor and redox transducer
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cal  Candida albicans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CaO19.86 (GPS2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CaO19.86 (GPS2)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CaO19.86 (GPS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 161 aa AA seqDB search
MSQFYELAPKDAKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNKKFADQPVQIL
GFPCNQFGHQEPGSNEEIGSFCSLNYGVTFPVLDKIEVNGDNTDPVYKYLKSQKSGVLGL
TRIKWNFEKFLIDQNGKVIERFSSLTSPESIGTKIEELLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaattttacgaattagctccaaaagacgccaaaggtgaaccatatccatttgaa
caattgaaagggaaagttgtccttatcgtcaatgttgcttccaaatgtggattcactcct
caatacaagggtttagaagaattgaataagaaatttgctgatcaaccagtacaaatcttg
ggtttcccatgtaatcaatttggccaccaagaaccaggtagtaacgaagaaattggatca
ttctgttcattgaactacggtgttacattcccagtcttggataaaattgaagtcaatggt
gacaataccgatccagtttataaatatttgaaatcacaaaagagtggtgttttgggattg
accagaattaaatggaattttgaaaaattcttgattgaccaaaatggtaaagttattgaa
agattcagttcattgactagtccagaaagtatcggtaccaagattgaagaattgttgaag
aaataa

DBGET integrated database retrieval system