KEGG   Candida albicans: CAALFM_C600850WAHelp
Entry
CAALFM_C600850WA  CDS       T00189                                 

Gene name
CaO19.86
Definition
(RefSeq) peroxiredoxin
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cal  Candida albicans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CAALFM_C600850WA (CaO19.86)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CAALFM_C600850WA (CaO19.86)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CAALFM_C600850WA (CaO19.86)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 161 aa AA seqDB search
MSQFYELAPKDAKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNKKFADQPVQIL
GFPCNQFGHQEPGSNEEIGSFCSLNYGVTFPVLDKIEVNGDNTDPVYKYLKSQKSGVLGL
TRIKWNFEKFLIDQNGKVIERFSSLTSPESIGTKIEELLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaattttacgaattagctccaaaagacgccaaaggtgaaccatacccatttgaa
caattgaaagggaaagttgtccttatcgtcaatgttgcttccaaatgtggattcactcct
caatacaagggtttagaagaattgaataagaaatttgctgatcaaccagtacaaatcttg
ggtttcccatgtaatcaatttggccaccaagaaccaggtagtaacgaagaaattggatca
ttctgttcattgaactacggtgttacattcccagtcttggataaaattgaagtcaatggt
gacaataccgatccagtttataaatatttgaaatcacaaaagagtggtgttttgggattg
accagaattaaatggaattttgaaaaattcttgattgaccaaaatggtaaagttattgaa
agattcagttcattgactagtccagaaagtatcggtaccaagattgaagaattgttgaag
aaataa

DBGET integrated database retrieval system