KEGG   Candida albicans: CaO19.86Help
Entry
CaO19.86          CDS       T00189                                 

Gene name
GPS2
Definition
one of four potential glutathione peroxidase genes; second of a repeat of three genes similar to S. cerevisiae HYR1 (YIR037W) thiol peroxidase/hydroperoxide sensor and redox transducer
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cal  Candida albicans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cal00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cal00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 161 aa AA seqDB search
MSQFYELAPKDAKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNKKFADQPVQIL
GFPCNQFGHQEPGSNEEIGSFCSLNYGVTFPVLDKIEVNGDNTDPVYKYLKSQKSGVLGL
TRIKWNFEKFLIDQNGKVIERFSSLTSPESIGTKIEELLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaattttacgaattagctccaaaagacgccaaaggtgaaccatatccatttgaa
caattgaaagggaaagttgtccttatcgtcaatgttgcttccaaatgtggattcactcct
caatacaagggtttagaagaattgaataagaaatttgctgatcaaccagtacaaatcttg
ggtttcccatgtaatcaatttggccaccaagaaccaggtagtaacgaagaaattggatca
ttctgttcattgaactacggtgttacattcccagtcttggataaaattgaagtcaatggt
gacaataccgatccagtttataaatatttgaaatcacaaaagagtggtgttttgggattg
accagaattaaatggaattttgaaaaattcttgattgaccaaaatggtaaagttattgaa
agattcagttcattgactagtccagaaagtatcggtaccaagattgaagaattgttgaag
aaataa

DBGET integrated database retrieval system