KEGG   Candida albicans: CaO19.8669Help
Entry
CaO19.8669        CDS       T00189                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CaO19.8669
   01230 Biosynthesis of amino acids
    CaO19.8669
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CaO19.8669
  Energy metabolism
   00680 Methane metabolism
    CaO19.8669
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CaO19.8669
Enzymes [BR:cal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CaO19.8669
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CaO19.8669
  Exosomal proteins of melanoma cells
   CaO19.8669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 261 aa AA seqDB search
MGVHKLIILRHGESQWNHENKFCGWIDIPLSQKGKQEAIYAGELIKKNHLDPDILYTSKL
MRSIETGLTILEVLHKPWIDHIKTWRLNERHYGQYQGRDKHEVFVELGKDKEKFQYIRRD
YHGLPPLIEYGQDKSIDEKYKDVLNKDILPRGESLSMVMDRLIPFFKYEILDNQMIQLNK
TVLIVTHGSIVRSLIKYLNHVSDDDISKINVPTGIPLVFELNDRGELIKPYYYLDQEKAE
KGIAKVKMEGLERKGQTDEKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcataaattaataattctaagacatggagaatcacaatggaatcatgagaat
aaattctgtggatggattgatattccattatcacaaaagggcaaacaagaagcaatttat
gctggagaattaatcaaaaagaaccatcttgatcctgatatcttatatacatcgaaatta
atgcgatcaatagaaactggattgacaattttggaagtattacacaaaccatggattgat
catatcaaaacttggagattgaatgaacgacattatggtcaatatcaaggaagagataaa
catgaagtgtttgttgaattgggtaaagataaagagaaattccaatatattagaagagat
tatcatggattgccacccttaatagaatatggtcaagataaatcaattgatgaaaaatac
aaggatgtattgaataaagatatattacctcgaggagaatcattactgatggtgatggac
agattgattccgtttttcaaatatgaaatattagataatcaaatgattcaattgaataaa
actgttttgatagtgactcatggttcaattgttagaagtttgatcaaatatcttaatcat
gtaagtgatgatgatatatccaagattaatgtccctacaggtataccattggtatttgaa
ttgaatgatagaggtgaattgatcaaaccttattattatttggatcaagaaaaggcagaa
aaggggatcgccaaagtgaaaatggaaggtcttgaaagaaaaggacaaacagatgaaaaa
ctataa

DBGET integrated database retrieval system