KEGG   Candida albicans: CaO19.895Help
Entry
CaO19.895         CDS       T00189                                 

Gene name
HOG1
Definition
MAP kinase involved in osmoregulation; identified by functional complementation of S. cerevisiae hog1 (YLR113W) deletion mutant.
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cal  Candida albicans
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cal00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CaO19.895 (HOG1)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CaO19.895 (HOG1)
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CaO19.895 (HOG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 377 aa AA seqDB search
MSADGEFTRTQIFGTVFEITNRYTELNPVGMGAFGLVCSAVDRLTGQNVAVKKVMKPFST
SVLAKRTYRELKLLKHLKHENLITLDDIFISPLEDIYFVNELQGTDLHRLLNSRPLEKQF
IQYFTYQIMRGLKYIHSAGVIHRDLKPSNILINENCDLKICDFGLARLQDPQMTGYVSTR
YYRAPEIMLTWQKYDTEVDLWSVGCILAEMIEGKPLFPGKDHVHQFSIITELLGSPPADV
IDTICSENTLRFVQSLPHRDPIPFSERFASCTHVEPEAIDLLAKLLVFDPKKRISAVEGL
THPYMEAYHDPTDEPVCESKFDWSFNDADLPVDTWRVMMYSEILDFHQTVGVANETEGSE
QPDSQVEQNNLDSANGA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagatggagaatttacaagaacccagatatttgggactgtttttgaaatcacc
aatagatacactgagctaaatcccgtgggaatgggagcatttggtttggtgtgctcagcc
gttgatagattaactggtcaaaatgttgcagtgaaaaaagtcatgaaaccttttctgacc
tcagtattggcaaaaagaacctacagagaattaaagttattgaaacatttgaaacatgag
aatttgattaccttggatgatattttcatatctcctttggaggatatttactttgtcaat
gaattgcaaggtactgatttgcataggttattgaactcaagacctttggagaaacaattt
attcaatatttcacataccaaataatgagaggtttaaaatacattcattctgccggtgtt
attcatcgtgatttgaaaccatccaacatcttgatcaatgaaaactgtgacttgaaaatc
tgtgactttggtcttgcaagacttcaagatccacaaatgacgggttacgtgtcaaccaga
tattatcgagcaccagaaatcatgttaacttggcaaaaatacgacactgaagtcgacttg
tggtctgtgggttgtatcttagcggaaatgattgaagggaaaccactattccccgggaaa
gatcacgtgcatcaattctccattataacagaattattgggctcacctcctgctgatgtg
atcgatactatttgttccgaaaacactttaagatttgtccaatcattaccacatagagac
cctatcccatttagtgaaagatttgcttcctgtactcacgttgaaccggaggctattgat
ttattggctaaattgttggtttttgaccctaagaaaagaatcagtgctgttgaaggtttg
acccatccttatatggaggcataccatgatccaaccgatgagcctgtttgtgagagtaaa
ttcgattggagttttaatgacgcagacttgccagtggatacttggagagttatgatgtac
agtgaaattttagactttcatcaaactgttggtgtggcaaatgaaactgagggttccgaa
caaccagacctgcaagtggagcaaaacaacttggattccgccaacggagcttaa

DBGET integrated database retrieval system