KEGG   Candida albicans: CaO19.898Help
Entry
CaO19.898         CDS       T00189                                 

Gene name
HEM2
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cal  Candida albicans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CaO19.898 (HEM2)
Enzymes [BR:cal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CaO19.898 (HEM2)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CaO19.898 (HEM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 341 aa AA seqDB search
MVHQAEFLPSTGNSISSVLQGGYNHPLSREWQQERQLTKNMFIFPLFITDSPDEETAIPT
LPNIKRFGVNKLIPYVKNLVEKGLRAVILFGVPLKPGVKDALGTAADDPEGPVITAIKKL
RENFPDLFIMCDVCLCEYTDHGHCGILNEDGSLIREESVQRIAAVAVNYAKAGANSVAPS
DMMDGRIKDIKTGLMNAGLANKCLVMSYAAKFSGNLYGPFRDAAGSAPSHGDRKAYQLPP
GGAGLARRALMRDMSEGADAVIVKPSTFYLDIVSDAAKLCRDYPICAYHVSGEYAMLHAA
ADKGVVDLKGIAFEAHQGFLRAGARLIISYFTPEFLEWLQV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtccatcaagctgaatttttaccttctacaggtaattctatatcatctgtcttacaa
ggtggatataatcatccattgtctagggaatggcaacaggaaagacaattgaccaaaaat
atgttcattttcccattgtttattactgattcaccagatgaagaaactgcgatccccaca
ttgccaaacatcaagcgttttggtgtaaataaattgattccctatgtgaaaaacttggtt
gaaaaagggttgagagctgtgatattgtttggagttccattgaagccaggtgtcaaggat
gcattgggtacagctgcagatgatcctgaaggaccagttattaccgcgatcaaaaaatta
cgtgaaaatttccctgatttatttatcatgtgtgatgtttgtctttgtgaatacacagat
catggacactgtgggatattgaatgaagatggatcattgataagagaggaatcagtacaa
agaattgccgcagtggcggtcaactatgcaaaagcaggtgcaaactctgttgctccttca
gatatgatggatggacgtatcaaagatatcaagaccgggttaatgaatgctggtttagcc
aacaagtgtttggtcatgtcgtatgcggccaaattctctggcaacttgtatggaccattt
cgtgacgctgctggaagtgcaccaagtcatggagatagaaaagcataccaattaccacca
ggaggtgctggtttggcacgtcgtgctttgatgagagacatgagtgaaggtgctgatgca
gttattgtgaaaccaagtaccttctacttggatattgttagtgatgcagccaaattatgc
cgtgattatccaatatgtgcataccatgttagtggagaatatgccatgttgcatgcagca
gccgataaaggagttgttgatttaaagggaattgcatttgaagcccatcaaggattttta
cgagcaggggcaagattaattattagttatttcaccccagagtttttagaatggttgcaa
gtatga

DBGET integrated database retrieval system