KEGG   Candida albicans: CaO19.9091Help
Entry
CaO19.9091        CDS       T00189                                 

Gene name
UBP14
Definition
ubiquitin hydrolase
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 794 aa AA seqDB search
MTLELPSDIPSTIPANTKIYKDDCMYSFDTPENNLLGLDIDLKTYRAYSRNKDFNYTKQN
YDKTGNYLYLNIKKTLKPQEERNKLLYDDNGEKSPKIQKLEIKNVSDDDYYNTEISIYDI
KDDKSYSRDELSDEFNNLIDLILSANSSATEDEIKQWEQEIVPCPHSIDVEQFETDNLDL
TKCSQCDLRENLWICLHCGALGCGRQQYGSTLKGNGHALAHYELAQHPVAIKLGSLSADS
ESCDAYCYQCNDEVKVPHLAEKLHKFGIDLNTAVKTEKSLIELNIDQNLNWEFKLDGVNG
ERLEPVYGKGLTGLQNLGNSCYINSVLQALYTLNGYQEYFKDKKFPDINNPAIDLTSQLI
KLYDGLHSGRYSVPGSLKGDDYQLGIKPSTFKNLIGENHPEFKTQRQQDAFEFLLYFLDK
VDNELGLKLNEELKFLLGTKVVCANCSHGTLSNDLVDNISVPLEAEVIGKDEDGKKTYKE
VELIDSFKKYTTKEDIEGYKCENCHQQPGLAIKSTGFKTFPSTLIVNVQRIQLENWAPVK
VDVPITIPYNLDLSEFKAPVFETGEIESEQIQPESDNNKFVPNEEAMTTLLSMGFPEPRC
IKSLYHTGNSNAEDAMNWIFAHMDDADIDDPFNPNDSHGGASTTTTDDSGPSQDLIDNVA
AMGFSTQLAKKALVLNNNDISAAVEWLFANPDDDGILEDNNQSGPVVNVKQEKSELITKL
NADTQSNGKYELQSVICHKGTSPHTGHYVVFIKKLIDNEYKWVLFNDEKVVVCDDANLQD
IKNNAYVYVFRKVE
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgacattagaattaccttcggatatcccgctgaccattcctgcaaatactaaaatttac
aaagatgattgcatgtattcttttgatacaccagagaacaatttgttaggattggatatt
gatcttaaaacatatcgggcttattctcgaaacaaggatttcaattacaccaaacaaaat
tatgacaaaacggggaattatttgtatttgaatatcaaaaaaactttaaaaccacaagaa
gaaagaaataaattattgtatgacgataatggtgaaaaatctcccaaaatacagaaattg
gaaatcaaaaatgtatctgatgatgattactacaacactgaaatatccatttatgatatc
aaagatgataaaagttatagtagagatgaattgagtgatgagttcaacaacttgattgat
ttaattctttcagcaaactcttctgccacagaagatgaaattaaacaatgggaacaagaa
attgttccttgtcctcattcaattgacgttgaacaatttgaaactgataatttggatttg
actaaatgtagtcaatgtgatttgcgtgaaaatctttggatatgtttacattgtggtgcc
ttggggtgtggtagacaacaatatggatcgacattgaaaggtaatggacatgctttagct
cattatgaattagctcagcacccggtagcaatcaaattgggatcattatcagctgattct
gaaagttgtgatgcatattgttatcaatgtaatgatgaagtcaaagtgccccatttggca
gagaaattacacaagtttggtattgatttaaatactgcagtaaaaaccgagaaatcattg
attgaattaaatatagaccaaaatttgaattgggaatttaaattagatggagttaatggt
gagagattagaacctgtatatggtaagggcttgacgggtttacaaaatttgggcaattct
tgttatataaattcggtactccaagccctttacacattaaacgggtatcaagagtatttc
aaagacaaaaagttccctgatataaataatcctgcaattgatttaacaagtcaattaatc
aaactttacgatgggttacacagtggcaggtattcagttcctggttcattgaaaggtgat
gattatcaattaggaatcaaaccttctacatttaaaaatttgattggtgaaaaccatcca
gaatttaaaactcaacgacaacaagatgcatttgagtttttgttatattttcttgacaaa
gtggataatgaattgggattgaaattaaacgaggagctaaaattcttacttggtactaaa
gttgtctgtgccaattgttctcatgggactttgtcaaatgatttagtggacaatatttct
gtgccattggaagccgaagtaattgggaaagatgaagatggcaaaaaaacttataaagaa
gttgaattgatcgatagcttcaaaaagtataccaccaaggaagatatcgaaggatacaag
tgtgaaaattgtcatcaacaacctggtttagcaattaaactgacagggttcaagactttc
ccatcaactttaattgtcaatgttcaaagaattcaattagaaaattgggctccagtcaaa
gttgatgtaccaattacaataccatataatttggatctatctgaatttaaagctcctgtg
tttgaaactggggaaattgaatctgaacaaatacaaccagagtcggacaataataagttt
gttcccaatgaagaagcaatgacaaccttattaagtatgggtttcccagaaccaagatgt
attaaaagtttatatcatactggtaatagtaatgccgaggatgctatgaattggattttt
gcccatatggacgatgccgatatagatgatccattcaatccaaacgattctcatggtggt
gcctctactactactactgatgattccggtccttcacaagatttgatagacaatgtagct
gctatgggattttctacacaattagcaaagaaagcgttggtattgaacaataatgatata
agtgctgctgttgaatggttatttgctaatccagacgatgatggaattcttgaagacaac
aaccagagtggtccagttgtcaatgttaagcaagaaaaatcagagttaataacaaaatta
aatgcagatactcaatcaaatggtaaatacgagttacaatcagttatatgtcacaagggt
acatccccacatactggtcattatgttgtttttatcaaaaaacttattgataatgaatac
aaatgggtattgtttaatgacgaaaaagttgtggtttgtgatgatgccaatttacaagat
ataaagaataatgcttatgtctatgtatttagaaaggtagagtag

DBGET integrated database retrieval system