KEGG   Candida albicans: CaO19.920Help
Entry
CaO19.920         CDS       T00189                                 

Gene name
RMT2
Definition
Protein Arginine Methyltransferase
Orthology
K18477  
protein arginine N-methyltransferase 2 [EC:2.1.1.-]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     CaO19.920 (RMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 412 aa AA seqDB search
MSELHDLCKFPTRPIDQSYIDKLTQYLKDGIPATYTIEEAYNYINNIEEEPTTTTTPLHL
ICSHAPFDITKEEQEIISTMVEKLFEYGAGWSFTDINNQTPGCILISRRKERENKEEDGK
WMNDVYQQIIDAGVRAELLLRKVNEFEEIEFIEEDDEQEEKEEEDIPQLVKDEQEIKEEA
KQEQTTTTDIKPVVIDDAPDAPSQNQQSYLNTKLEYINDALITKDDKDGVMMAWENDIMK
LASDTITSSASSASDSESEQEVNILNIGFGMGIIDAMIQSKLKSHPNAKHYICEAHPDVL
QKMKIDGWYEKPNVIILEGRWQDKLNDLLSSSSSSSEASVFFDGIYYDTFSEHYQDMLEL
FDIIVGLLKPHGIFSFFNGLGADRQIIYEVYKNLLIIDLENYGLNCQFKEFN
NT seq 1237 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattacatgatttatgtaaatttccaactcgaccaatagatcaatcatatatt
gataaattgactcaatatcttaaagatggaattcccgcaacttacacaatcgaggaagcg
tataattatattaataatattgaggaagagccaacaacgacaacaactccattacattta
atatgtagtcatgctccatttgatatcaccaaagaagaacaagaaataatctctacaatg
gtggagaaattatttgaatatggagcaggatggagttttactgatattaataatcaaacc
cctggatgtattttaatatcaagaagaaaagaaagagaaaataaggaagaggatggaaaa
tggatgaatgatgtatatcaacaaatcattgatgctggagttagagcggaattattgttg
agaaaagtaaatgaatttgaagaaattgaatttattgaagaagatgatgaacaagaagaa
aaagaagaagaggatattcctcaattggttaaggatgaacaagaaatcaaagaggaagca
aaacaagaacaaactactactacagacattaagcctgtcgttattgatgatgcacctgat
gcaccatcacaaaatcaacaatcatatttaaatacaaaattagaatatattaatgatgca
ttaattacaaaagacgataaagatggagtaatgatggcatgggaaaatgatattatgaaa
ttagccagtgataccataaccagctcagccagctcagcctctgattcggaactggaacag
gaggtgaatattttaaatattggatttggaatggggataattgatgctatgattcaatca
aaacttaaatctcatccaaatgctaaacattatatatgtgaagctcatcctgatgtatta
caaaaaatgaaaatagatggatggtacgaaaaacccaatgttataatattagaaggaaga
tggcaagataaattaaatgacctattatcatcatcatcttcttcttcagaagcttcggtt
ttttttgatgggatttattatgatacatttctggaacattatcaagatatgttagaatta
tttgatattatagttggattattaaaacctcatgggattttctcatttttcaatggatta
ggagctgatagacaaataatttatgaagtttataaaaatttattaattattgatttagaa
aattatggattaaattgtcaatttaaagaatttaatg

DBGET integrated database retrieval system