KEGG   Candida albicans: CaO19.9287Help
Entry
CaO19.9287        CDS       T00189                                 

Gene name
SGA1
Definition
Glucoamylase, sporulation-specific
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cal  Candida albicans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cal00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 564 aa AA seqDB search
MRLLSFNLFIIFIINLGYVNSFLIPTKGLNLFHLQQQQQQSIFSTNLKQALTTPPPNSFY
DWLVFQKQVCLKSILNNIGGDFTIDNKDLLPGVVIASPSTSNPDYYYQWTRDSAIIINIL
IDHLSQTPLHLINKNSTSSLVHIIESYIFNTQILQQLPNLSGNVDNLENLGEPKFHVNLT
AFNESWGRPQRDGPGLRSIAIMNYLSLLNNTQHQPSFSNLTMNNTSKIYHDIIKPDLKYS
IEFWQFEGFDLWEEIKGIHFFTSLVQLKSLTMGLKFAQFYNDSFEFRLDIMNSIELLTKY
IELESGFINNEDSDGDEDNEQQLLSKSYIISSPKLFYTKSRSGLDIASILAVLYTHNNNN
ANDDDDNDFPFDVDNGLVLTTLRYLIQDMTLRYPINFQDNFQGVALGRYPEDIYDGYGKS
EGNPWFISTATASELIYRLIYKLKSNNQAIIIDQKNIEFYKEFIHSVSATEISNNELKFE
AHINGHPMMIINKDDKLYDELINKLFHYADGFLKVVQKHVDNNGDMNEQFNKYIGFMQGA
EKLTWSYGAVFTAINWRNKTLSIL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgagattgttgtcattcaatttatttatcatctttatcattaatctaggttatgttaat
tcatttttaataccaacaaaaggattaaacctttttcatctacagcaacagcaacagcaa
tcaatattctcaactaatcttaaacaagctctaaccacaccaccaccaaattcattttat
gattggttagttttccaaaaacaagtttgtttgaaatcaatactcaataatattggtgga
gatttcactattgataacaaagatttattgccaggggtggttatagcatcaccgtcaact
tcaaatcctgattattactatcaatggacaagggattctgctattataataaatatcttg
attgatcatttatcccaaactccattgcatttgataaacaaaaattcaacttcaagtttg
gttcatattattgaatcatacatttttaatacccaaattttacagcaattacccaattta
tctggtaatgttgacaacttggaaaatttaggtgaaccaaaatttcatgtcaatttgact
gcatttaatgaatcttggggtcgtcctcaacgagatggaccaggattaagatcaattgcc
ataatgaattatctaagtttattgaacaatacccagcatcaaccatcattttctaatttg
acaatgaataatactctgaaaatatatcatgatattataaaaccagatttaaaatattca
attgaattttggcaatttgaaggatttgatttatgggaagaaatcaagggtattcatttt
ttcactagtttggtccagttaaaaagtttaactatgggattaaaatttgcacaattttat
aatgattcatttgaatttagacttgatataatgaatctgattgaattattgactaaatat
attgaattggaatcagggtttatcaataacgaagatagtgatggcgatgaagacaacgaa
caacagttgttatcaaaatcatatataatttcatccccgaaattgttctataccaaatca
agaagtggattagatattgcttcaattcttgctgtattgtacacccacaataataacaat
gctaatgatgatgatgataacgatttcccatttgatgtagataatggattggtattaaca
acattaagataccttattcaagacatgacattaagatatccaataaatttccaagataat
tttcaaggagtagcattaggtcgataccctgaagatatttatgatggatatggtaaatca
gaaggaaatccttggtttataagtactgcaactgcaagtgaattgatttatcgattaatt
tataaattgaaactgaataatcaggcgattataattgatcaaaaaaatatcgagttttat
aaagaatttattcacagtgtcagtgcaacagaaatttccaataatgaactaaaatttgaa
gcccatattaatggacatccaatgatgatcatcaataaagatgataaattatatgatgaa
ttaatcaataaattattccattatgctgatgggtttttaaaagttgttcaaaaacatgtt
gataataatggtgatatgaatgaacaatttaataaatatattggattcatgcaaggcgca
gaaaaattgacttggagttatggagctgtatttacagcaattaattggcgtaataaaact
ttatcaattttataa

DBGET integrated database retrieval system