KEGG   Candida albicans: CaO19.9305Help
Entry
CaO19.9305        CDS       T00189                                 

Gene name
UGP1
Definition
similar to S. cerevisiae UGP1 (YKL035W) uridinephosphoglucose pyrophosphorylase involved in protein amino acid glycosylation
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cal  Candida albicans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cal00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cal00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cal00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cal00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 472 aa AA seqDB search
MRNALNNLADTVENPEQTTRFENEMDNFFTLFRRYLTEKASGSTLDWDKIRSPSSDEVVE
YGDLNSANNSANLSKLAVLKLNGGLGTSMGCVGPKSVIEVRDGNNFLDLAVRQIEHLNRK
YDADVPLLLMNSFNTDADTEKIIKKYQSHRIRVKTFNQSRFPRIYKDSLLPVPESFDDSL
EAWYPPGHGDLFEALVQSGELDALLAQGREILFVSNGDNLGATVDSKILDHMIETGAEYI
MELTPKTRADVKGGTLINYQGEVRLLEIAQVPKEHVEEFKSIKKFKYFNTNNLWINLRAI
KKLVEANAIEVEIIPNQKTISHGKSDINVLQLETAVGAAIRHFKGAHGVVVPRSRFLPVK
TCSDLLLVKSDLFYLEHGALVLDPTRDGFSNPLIKLGSHFKKVSGFQSRIPYIPKILELD
HLTITGNVTIGKGVQLKGTVIIVCNDGDKIDIPNGAILENVVVTGNLTILEH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatgcattgaacaacttggctgatactgttgaaaacccagaacaaacaaccaga
ttcgaaaatgaaatggacaatttctttactttgttcagaagatatttaactgaaaaggca
tcaggatccactttggattgggataaaatcagatctccatcttccgatgaagttgttgaa
tacggtgacttgaacagtgccaacaactctgctaatttatctaaattggcagttttgaaa
ttgaatggtggtttaggtacttccatgggatgtgttggtcctaaatcagtcattgaagtt
agagatggtaacaatttcttggatttggctgtcagacaaattgaacacttgaacagaaag
tatgatgccgatgttccattattgttaatgaactctttcaacactgatgctgacaccgaa
aagatcattaagaaatatcaaagccacagaatcagagtgaaaacttttaaccaatccaga
ttcccaagaatttacaaagattctttacttccagttccagaatcatttgatgactctctt
gaagcttggtatcctccaggtcatggtgatttgtttgaagctttggttcaatctggtgaa
ttggatgccttgttagctcaaggaagagaaatcttatttgtttctaatggtgataatttg
ggtgccaccgttgactccaagattttggaccacatgattgaaactggtgctgaatatata
atggaattgactcctaagaccagagctgatgttaaagggggtactttaatcaattatcaa
ggtgaagtgagattattggaaattgctcaagttccaaaagaacacgttgaagaattcaag
agtattaaaaaattcaaatactttaacactaataacttgtggatcaacttgagagccatc
aagaaattagtcgaagctaatgccattgaagtggaaatcattccaaaccaaaagactatt
tctcatggcaaatcagatatcaatgtgttgcaattggaaactgccgttggtgcagccatc
agacactttaaaggtgcccacggggttgttgttccaagatcaagattcttaccagttaaa
acctgttctgatttgttactagtcaaatccgatttattctacttagaacacggtgctttg
gtattagatccaactagagatgggttctctaacccattgattaaattgggttctcatttc
aagaaagtcagtggattccaatctagaattccttacattccaaagattttggaattggat
catttgaccattacaggtaatgttacaattggtaaaggcgttcaattgaaaggaacagtg
attattgtttgtaatgatggtgacaaaattgatattccaaatggtgctatcttagaaaat
gttgtggttactggtaacttgactatattggaacattaa

DBGET integrated database retrieval system