KEGG   Candida albicans: CaO19.9310Help
Entry
CaO19.9310        CDS       T00189                                 

Gene name
ACS1
Definition
similar to S. cerevisiae ACS2 (YLR153C) acetyl-CoA synthetase; same as cosmid orf Ca38F10.03
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cal01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cal00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cal00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cal00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:cal00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 675 aa AA seqDB search
MPESTQQSHLSLDHEKMQQPPKGFTERSKTKPNLPDFETYQKLYKQSIENPNEFFTQQAK
ENLDWFKPFDLARFPIDPKDDYKNGDLPAWFINGQLNACYNAVDRWAIKNPDKPAIIYEG
DEPDQGRIITYGELLKQVSKLAQALTKLGVKKGDSVAVYLPMIPEAIVTLLAIVRIGAMH
SVVFAGFSSASLRDRILDADSRIVITADESKRGGKTIETKKIVDDALKECPKVRNVIVFK
RTGNSHVPFSPGRDLWWHDEMAKYGPYFPPVPVNSEDPLFLLYTSGSTGKPKGVQHNTAG
YLLGAVLTTKYTFDVHEDDILFTAGDIGWITGHTYCVYGPLLAGATSVVFEGTPAYPNYS
RYWEIVDKYKVNQFYVAPTALRLLKRAGTKYVEKYDLSSLRVLGSVGEPIAAEVWHWYND
NIGRGQAHIVDTYWQTESGSHLLTPLAGITPTKPGSASLPFFGVDPKILDPTTGEELPDN
DVEGVLAIKSAWPSITRGIYNDYNRFIDTYLAPYANYYFSGDGAARDRDGFYWILGRVDD
VVNVSGHRLSTAEIEAALIEHPIVGESAVVGYADELTGQAVAAYVSLKKDKAVGEDVENI
KKEMILTVRKEIGPFAAPKMILLVDDLPKTRSGKIMRRILRKVLAGEEDQLGDISTLSNP
GVVQQIIDVVHHAKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgccggaatctactcaacaatctcatctttctttggaccatgagaagatgcaacaacct
cctaaagggttcactgaacgttctaaaacaaaaccaaacttacctgattttgaaacttat
caaaaattatataaacaatcaattgaaaaccccaatgaatttttcactcaacaagccaaa
gaaaatttggattggtttaaaccatttgatttagctagattccctattgatcctaaagat
gattacaaaaatggtgatttgccagcttggttcatcaatggacaattgaatgcttgttat
aatgctgttgatagatgggccattaaaaaccctgataaaccagcaattatttatgaaggt
gatgaacctgaccaaggaagaattatcacttatggagaattattaaaacaagttagtaaa
ttagctcaagccttaactaaattgggggttaaaaagggtgattcagttgctgtttattta
ccaatgattcctgaagccattgtcactttattagccattgttagaattggtgctatgcat
tcagttgtttttgctgggttttcttctgcttcattaagagatagaattttggatgctgat
tcaagaattgttattactgctgatgaatctaaaagaggtggtaaaaccattgaaaccaaa
aaaattgttgatgatgccttgaaagaatgtccaaaagttagaaatgtcattgttttcaaa
agaactggtaattctcatgtcccattttctcctggtagagatttgtggtggcacgatgaa
atggctaaatatggtccatacttcccaccagttcctgtcaattctgaagacccattgttc
ttgttgtatacttctggttctactggtaaaccaaagggggttcaacacaacactgctggt
tatttgttaggagcagttttaaccaccaaatacacttttgatgttcatgaagatgatatt
ttgtttactgctggtgacattggttggatcacaggtcatacttattgtgtttatggtcca
ttgttagctggtgccacatcagtggtttttgaaggtaccccagcttatccaaattattcc
agatattgggaaattgttgataaatataaagttaatcaattttatgttgctccaactgct
ttaagattattgaaaagagctggtaccaaatatgttgaaaaatacgatttatcatcttta
agagtcttgggttctgttggtgaaccaattgctgctgaagtttggcattggtataatgat
aacattggtaggggtcaagctcatattgttgatacttattggcaaactgaatcaggatct
catttgttgactccattagctggtatcacaccaactaaaccaggttcagcttcattacca
ttctttggagttgatccaaagattttagacccaaccactggtgaagaattacctgataat
gatgttgaaggggttcttgccattaaatcagcttggccatcaattactagaggtatttac
aatgattacaatagatttattgatacttatttggcaccatacgccaattattatttctcc
ggtgatggtgctgctagagatagagatggtttttactggattttgggtagagttgatgat
gttgttaatgtttctggtcacagattatcaactgctgaaattgaagctgccttgattgaa
catccaattgtcggtgaatctgccgttgttggttatgccgatgaattgactggtcaagcc
gttgctgcatatgtttcgttaaagaaggataaagccgttggtgaagatgtagaaaacatt
aaaaaggaaatgattttaacagttagaaaagaaatcggaccatttgctgctccgaaaatg
attttattagttgatgatttacctaaaactagatctggtaagattatgagaagaatttta
agaaaagtattggctggtgaagaagatcaattgggtgatatttctactttatctaatcca
ggtgttgttcaacaaatcattgatgttgttcatcatgcaaagaaataa

DBGET integrated database retrieval system