KEGG   Candida albicans: CaO19.932Help
Entry
CaO19.932         CDS       T00189                                 

Gene name
DNF2
Definition
similar to potential aminophospholipid translocase ATPase involved in intracellular protein transport
Orthology
K01530  
phospholipid-translocating ATPase [EC:3.6.3.1]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.1  phospholipid-translocating ATPase
     CaO19.932 (DNF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1716 aa AA seqDB search
MTKNKHNFTLNNSSDGVNNNDDPSDHHDYSDDSMPPTPTISTFNKFPRQSSLRFKTPLPN
DTPRSSSSGSTSNNNNHNHNQKSPFLDENEASFDRKFGYNYDKDKVVEEEDENEDEATYV
VGEDNEDNEDENDNINEMDPSNLKTKRHRWGTTRHKHGRPKNENINRSKTLKKILAPHKS
KGKSHSKNSHSLNKRLLSIRKPNTHRVNFPHDNQPPPQDLDFEEQNDPKNRKSEKRTVTF
NRPLPPHLVDPETNKPLTNYPRNKIRTTKYTPLSFFPKNIWNQFMHNVANIYFLVLIILG
AFEIFGVPSPVLAAVPLIVIVIITAIKDAIEDSRRTVTDLEVNNQITHILTQVNEDAANG
YHYENVNVDDEQVSYWRQFKKWNTRLLIRFWGASKRNLTKEGRANKIRERYNRENNIDGD
GDQQQGRKSFDSDIVSNRTSFEQTENPFNDTLRQSFQQQRQQQQRQSSSYRHKTMKFAKK
YWKDVKVGDVLRIYNNDEVPADLVILATSDEDNCCYVETKNLDGETNLKVKQALKYSSIN
EKIHKADDLINHDFEIDSEGPHANLYSYQGNLKYTNRMNNSQSYDNHEDSQEAITINNLL
LRGCTLRNTKWAIGIVVFTGDDTKIMLNAGVTPTKQSRMSRELNYYVLLNFILLFVICFI
SGLVNGIYYRETNTSRDYFEFGTIASTPALNGLVGFFVSLILYQSLVPISLYITIEIIKT
AQAFFIYSDVGMYYSKLDFPCTPKSWSISDDLGQIEYIFSDKTGTLTQNLMEFKKCTING
VSYGKAYTEALAGLRKRMGIDVEIEAAQERELISRDKEVMIEKLHTINKNKTYDDEITFV
SSEFIDDLTDSSINNQSQRESNHHFMLALALCHSVMTEPDPKQPNKLMLKAQSPDEAALV
GTARSLGFNFKGTTKTGVIVDVHGETKEYQVLNTLEFNSTRKRMSSIIKIPGEGPNDEPR
ALLICKGADSIIYERLSATENDPSMLEKTSKHLEEYATEGLRTLCIAERELSWKQYVEWN
KRHQAAASSLDDREAKMEAVADSIERELTLLGGTAIEDRLQDGVPDAISILADAGIKLWV
LTGDKVETAINIGFSCNLLGNDMQLLVIKTAYNDDENGSNDDNSSEDKNSLQGLKFGHNA
SEPEIVDTVISYYLRKHFDMTGSFEEKEAAVGDHSPPDERFGVVIDGDALKLVLLSPDVK
RKFLLLCKKCRAVLCCRVSPAQKAAVVKLVKDTLNVMTLAIGDGSNDVAMIQAADVGVGI
AGEEGRQAVMSSDYAIGQFRYLARLLLTHGRWSYKRFSEMIPSFFYKNIIFNIALFWYGI
YCDFDGTYLFEFTYLMFYNLAFTSLPVIFLGIFDQDVEAKVSLLVPQIYRTGITRTEMSD
LKFYLYCLDGIYQSAISYFFPYLLYMVAFPNMNGKPVDHRFWMGVLVTCIACISCNCYIL
FHQFRWDWLSSLIVAISILIIFIWTGLWTVNYQSSGEFYKAAPEIFGMTAFWACMFVGIL
CCLIPRFFYDFVMRIFWPKDIDIIRECVARGDFEAYPFDYDPTDPNRPKISTYSSDVVHR
MSMNYPSPPQTQATSTDSNGKSPSSSSLDNGHQSRNSNNLNGNGYYDQDNSSGSNLTYDR
SIIFERVNESPINAHHQQPPTPPPGIIASPIRKRKGFVPSVFRNSSDSHIHHSNGHTNGS
SPGVATEEIPLEDFDDEQKRASRISYENQKRVSSMN
NT seq 5151 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaataagcacaatttcacgctaaataatagtagtgatggagttaataacaat
gacgaccctagtgatcaccatgattattccgatgattcaatgccaccaaccccaacaata
agtacgtttaataaatttcctcgacagtcatcattacgattcaagactcctttgccaaat
gatacaccacggtcgtcgtctctggggtctacatcaaataataataaccacaatcataat
cagaaatcgccgttccttgatgaaaacgaagcttcgtttgatcgaaagtttggttataat
tatgataaggataaagtggtagaggaagaagatgaaaatgaagatgaagcaacttatgtt
gttggtgaagacaatgaagacaatgaagacgaaaacgataatatcaatgaaatggatcca
tctaatctaaaaacaaagagacatcgttggggtactactcgtcataaacatggtagacct
aaaaatgaaaatatcaatcgatcgaaaactttgaagaaaatattggcacctcataaaagt
aaaggaaaatctcactcaaagaattcccattcccttaataaaagattactttcgatacgg
aaaccaaacactcatcgagtgaattttcctcatgataatcagccaccaccacaagatcta
gatttcgaagaacagaatgatccgaaaaatagaaaatcagaaaaaagaaccgtcacattc
aatcgaccattacctccccatttagttgatcccgaaactaataaaccactaacaaattat
cctcgtaataaaattagaacaacaaaatatactcccttgagttttttcccgaaaaacatt
tggaatcaatttatgcataatgttgctaatatctattttcttgtacttattattttgggt
gcatttgaaatctttggggttccgtccccagttttagcagccgtcccgttaattgttatt
gttattataacagccatcaaagatgccatagaagattcaagaagaacagtgactgatttg
gaagtcaataaccaaatcacccatatcttaactcaagttaatgaagacgctgccaatgga
tatcattatgaaaacgtcaatgttgatgacgaacaagtttcttattggagacaatttaaa
aaatggaacactcgattattaatcagattctggggagccctgaaacgtaatttaactaaa
gagggaagagccaataagattcgtgaacgatataatcgagagaataatattgatggtgac
ggtgaccaacaacaaggtagaaagtcattcgatagcgatattgtgtctaacagaacctca
tttgaacaaactgaaaatccatttaatgacacattaagacaatcattccaacaacaacgt
caacaacagcaacgccaatcctcatcataccgtcacaaaacaatgaaatttgccaaaaag
tattggaaagatgtcaaagttggagatgtgttacgaatttataataacgatgaagtccct
gctgatcttgtaattttggcaaccagtgatgaagataattgttgttatgttgaaaccaag
aatttagatggtgaaaccaatttaaaggttaaacaagcattgaaatactcttcaatcaat
gaaaaaatccacaaagccgacgatttgatcaatcatgattttgaaatcgactctgaagga
cctcatgcaaacttgtattcttatcaagggaatttaaaatataccaatagaatgaataac
tcacaatcatacgacaaccacgaagattctcaagaagcaatcactattaacaacttatta
ttgcgtggctgtacattgagaaatacaaagtgggctattgggatagttgtgtttactggt
gatgataccaaaatcatgcttaatgctggggtaacgccaactaaacaatcaagaatgtcg
cgagaattgaattattatgtcttgttaaattttattttattgtttgtcatttgttttatt
tctgggttagtcaatgggatatattatcgagaaacaaacacttcacgagattattttgag
ttcggtaccattgccagtacaccagcattaaatggtttagttggattttttgtatcattg
attttgtatcaatcattagtgccgatttctctttatattaccattgaaattatcaagact
gcacaagcattttttatttattctgatgtggggatgtattattctaaattggatttcccc
tgtactcccaaatcatggtcaatctctgacgatttgggacaaattgaatatattttcagt
gacaagaccgggacattaacacaaaatttaatggaattcaaaaaatgtacaattaatgga
gtttcttatggtaaggcttatactgaagcattggctgggttacggaaacgtatgggaatt
gatgttgaaatcgaagcagcacaagaacgtgagttaattagtcgtgacaaagaagttatg
attgagaaactacacactattaataaaaataaaacttatgatgatgaaataacatttgtc
tccctggaatttattgatgatttgactgactcttcaattaacaaccaactgcaacgtgaa
agtaatcaccactttatgttagctttggcattatgtcattcagttatgactgaaccagat
ccaaaacaaccaaataaattaatgcttaaagctcaatcacctgatgaagccgctttagtg
ggaacagctcgttctttagggtttaatttcaaaggtacaactaaaactggagtaatagtt
gacgttcatggagaaaccaaagaatatcaagtattgaacacattagaatttaactcaaca
agaaaaagaatgagttcaattataaagataccaggtgaggggcctaatgatgaacccagg
gcattattgatatgtaagggggctgattctataatttatgaacgtttatctgctaccgaa
aacgatccttccatgttggaaaagacttcaaaacatcttgaggaatatgccaccgaaggg
ttgcgtacattatgtattgctgaacgtgaattgagttggaaacagtatgttgaatggaat
aaacgtcaccaagctgctgcttcttcattagatgaccgtgaagcaaaaatggaggctgta
gccgattccattgaacgtgaattgactttgttaggtggtactgccattgaagatagattg
caagatggcgtaccagatgctatttccattttggctgatgctgggatcaagttatgggtt
ttaacaggtgataaagttgaaactgctattaatattgggttttcttgtaatttgttaggt
aacgatatgcaattgcttgtgataaagactgcctataatgatgatgaaaacggtagcaac
gatgacaattcttcagaggataaaaattctttacaaggattgaaatttggccataatgcc
agtgaaccagaaattgttgatacagtgatttcttattatttgcggaaacattttgatatg
actgggtcgtttgaagaaaaagaagccgctgttggtgaccattctccacccgatgaaaga
ttcggggtggttatcgatggtgatgctcttaaattggttcttttgagcccagatgtgaaa
aggaaatttttattactttgtaagaaatgtcgtgccgtattatgttgtcgtgtatcacca
gcacaaaaagctgctgtagtgaaattggtcaaggatacattaaatgtcatgactttagcc
attggtgacgggtcaaatgatgtggctatgattcaagcagccgatgttggtgtgggtatt
gctggtgaagaaggtcgacaagcagtcatgtcttcagattatgcaattggacaattccgg
tatttggcaaggttattgttaacacatgggagatggtcgtacaaacgatttagtgaaatg
atcccaagttttttctacaaaaatatcattttcaatattgcattgttttggtacggaatt
tattgtgatttcgatggaacatatttatttgaattcacttatttgatgttttacaattta
gcatttacttcgttacctgtgattttcttggggatttttgatcaagatgtggaagcaaaa
gtatcattgttagtaccacaaatttatcgtacaggtattactagaacagaaatgagtgat
ctcaaattttatttgtattgtcttgatggaatttatcaatcagcaatatcatattttttc
ccctatttgttatacatggtggcattccctaatatgaatggtaaaccagtggatcatcga
ttttggatgggggtgttagttacatgtattgcttgtatttcatgtaattgttacatattg
ttccatcagttccgatgggattggttgagttcattgattgtggccatttctattttgatt
atttttatttggacagggttatggactgttaattatcaatccagtggagaattttacaag
gccgctccagaaatatttggcatgacagcattctgggcatgtatgtttgttgggatttta
tgctgtcttattccaagatttttttatgattttgttatgaggatattttggcccaaagat
attgatatcattagagaatgtgttgctcgaggtgatttcgaagcatatccatttgattat
gatcctactgatccaaatcgcccgaaaatcagtacttattccagtgacgttgttcataga
atgagcatgaattatccttcaccaccacaaacccaagcaacatccactgatagtaatggc
aagtcaccatcgtcgtcatcacttgataacggtcatcaaagtcgaaactccaacaacctt
aatggtaatggctattatgatcaggataatagtagtggtagtaacttgacatatgataga
tcaataatatttgagcgagttaatgaatcaccaataaatgctcatcatcaacagccacct
actccaccaccaggaataattgctagtccaataaggaaaagaaaaggatttgtcccatca
gtgtttagaaatagtagtgatagtcatatccaccattctaatgggcataccaatggatca
agcccaggggtagctacagaagaaattccattagaagattttgatgatgaacaaaaaaga
gcatctagaataagctacgaaaatcaaaaaagagtatcttcaatgaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system