KEGG   Candida albicans: CaO19.9324Help
Entry
CaO19.9324        CDS       T00189                                 

Gene name
SET2
Definition
likely protein lysine methyltransferase similar to S. cerevisiae SET2 (YJL168C) histone lysine methyltransferase, transcriptional repressor
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cal  Candida albicans
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cal00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 844 aa AA seqDB search
MSNNNFQESSNNTSSPSKRSTPMLFLDAENKTQEALTTFELLNACTYQNKYVGSANVTTT
ATTSTKTSNSTSTKSHQQQHRRKLEYMTCDCEEEWDSELQMNLACGPDSNCINRITCVEC
VNRNCLCGDDCQNQRFQNRQYSKVKVIQTELKGYGLIAEQDIEENQFIYEYIGEVIDEIS
FRQRMIEYDLRHLKHFYFMMLSNDSFIDATEKGSLGRFINHSCNPNAFVDKWHVGDRLRM
GIFAKRKISRGEEITFDYNVDRYGAQSQPCYCGEPNCIKFMGGKTQTDAALLLPQMIAEA
LGVTPRQEKAWLKENKSIRNQQQNDESNINEEFVNSIEIEPIENQDGVTKVMSALMKTQH
PLIIKKLIERIFLSNDQDDINVMFVRFHGYKTISTILQDLLVAKNSGKESETTDNNDIDN
STGDDDQDKDELIIKILKILVSWPAVTKNKIASANLEEVVKDIQTNNENSNNNDEINQLC
TSLLDRWSKLEMAYRIPKQESVPTNNAAAAATTTATATGTTTSASPFERISSHTPEVGGT
NTPSSTSQQQQQQNSRDAGLPENWRSAFDKNTGGYYYYNLVTKETTWERPLGSLPLGPKP
PSGPGLKGRINKYNEIDLAKREELRIQKEKEMKFIEMQNRDRKLKELIEMSKKSMNNIGG
SSGTTITAATINGLSDNGGNNNGNITGIYGDDKHSKHHHHHHDKHLKNGPRNTSTSSSSG
NNVEKIWKRIFAKYIPNIIKKYESEIGRDNVKGCAKELVNILTQSEIKHGNSLPSSSSSN
GYSMELSDKKLKKIKEYSHGYMDKFLIKFNNSKKHKSTMGSKGSDNHKRKHNGDGDNGVK
RSKV
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataacaactttcaagagagttctaataacactagcctgccttctaaacgatcg
acaccaatgttgtttcttgatgccgaaaacaaaactcaagaagcattaacaacttttgaa
ttactaaatgcatgtacatatcaaaacaaatatgttggatcggccaacgtcaccactact
gccactaccagtactaaaacatctaactcaaccctgactaaatctcatcaacaacaacat
cgtcggaaacttgaatatatgacatgtgattgtgaagaggaatgggatagtgaattacaa
atgaatttagcgtgtggacccgattctaattgtattaatcgaattacttgtgttgaatgt
gttaataggaattgtttatgtggggatgattgtcaaaatcaacgatttcaaaaccgtcaa
tatagtaaagtcaaagttattcaaacggaattaaaaggttatggattaattgctgaacaa
gatattgaagaaaatcaatttatttatgaatatattggtgaagttatagatgaaattagt
ttccgtcaacgaatgattgaatatgatttacgacatttaaaacatttttattttatgatg
ttaagtaatgattcatttattgatgccacggaaaaagggtcattaggtcgatttattaat
cattcttgtaatcctaatgcatttgttgataaatggcatgttggtgatcgattaagaatg
gggattttcgctaaaaggaaaatttcccgtggtgaagaaattacatttgattataatgtt
gatagatatggagctcaatctcaaccatgttattgtggtgaaccaaattgtataaaattc
atgggtgggaaaactcaaactgatgctgcattattattaccacaaatgattgctgaagca
ttaggagtaacaccaagacaggaaaaagcttggcttaaagaaaataaatcaattagaaat
caacaacaaaatgatgaatcaaatataaatgaagaatttgttaatagtattgaaattgaa
ccaattgaaaatcaagatggggtgactaaagtaatgtcagcattgatgaaaactcaacat
cctttaattattaaaaaattgattgaaagaatatttcttagtaatgatcaagatgatatt
aatgttatgtttgttagattccatggatataagacaatatcaacaattttacaagattta
ttagtggccaagaatagtggtaaagaatcagaaacaactgataacaacgatatcgacaac
tctactggagatgacgatcaagataaagatgagttgattattaagattttgaaaatattg
gtgagttggccagcagttactaagaataaaatagcttcagctaatttagaagaagttgtt
aaagatattcaaaccaataatgaaaatagtaataataatgatgaaattaatcaattatgc
actagtttattagatagatggtcaaaattagaaatggcttatcgtattcctaaacaagag
agtgtacctaccaacaatgctgctgctgctgctacaacaactgcaactgccaccggcacc
actacttcagcatctccatttgaaagaatatcatctcatacaccagaagtaggtggtacc
aatacaccatcatcaacctcacaacaacaacaacaacaaaattcacgagatgcgggatta
ccagaaaattggcgtagtgcatttgataaaaacactggtggatattattattataatctt
gttactaaagaaactacctgggaaagacctttgggttcattaccattaggaccaaaacca
ccaagtggaccaggcttaaaaggtcgaattaataaatataatgaaattgatttagctaaa
agagaagaattaagaattcaaaaggaaaaagaaatgaaatttattgaaatgcaaaatcga
gatcgtaaacttaaagaattgattgaaatgagtaaaaaatcaatgaataacattggtggt
agtagtggtactaccattactgctgctactattaatggtttatctgataatggtggaaat
aacaatgggaatattactggtatttatggagatgataaacactcaaagcatcatcatcat
catcatgataagcatttgaaaaatggtcctagaaataccagcaccagcagtagtagtggt
aataatgttgagaaaatttggaaacgaatatttgctaaatatattcctaacattattaaa
aaatatgaatcagaaattggtcgtgataatgttaaaggatgtgccaaagaattagttaat
attttaacacaaagtgaaatcaagcatggtaatagtctaccctcatcatcttcttcgaat
ggttatagtatggaattgagtgataaaaaattgaaaaaaataaaagaatacagtcatgga
tatatggacaaatttttaattaaatttaataattccaaaaaacacaaatctacaatgggg
agtaagggaagtgataatcataaacgaaagcataatggtgatggagataatggagtaaaa
cgtagtaaagtatag

DBGET integrated database retrieval system