KEGG   Candida albicans: CaO19.9339Help
Entry
CaO19.9339        CDS       T00189                                 

Gene name
CYC1
Definition
cytochrome c capable of functionally substituting for S. cerevisiae CYC1 (YJR048W) mitochondrial iso-1-cytochrome c
Orthology
K08738  
cytochrome c
Organism
cal  Candida albicans
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CaO19.9339 (CYC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 110 aa AA seqDB search
MPAPFEKGSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGVFGRKSGLAEGYSYTDANK
KKGVEWTEQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLVTYLKKATS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatttgaaaaaggttcagaaaagaaaggtgccactttatttaaaactaga
tgtttacaatgtcacaccgttgaaaaaggtggtccacacaaagttggtccaaatttgcat
ggtgttttcggtagaaaatccggtttagctgaaggttattcttatactgatgctaacaag
aagaaaggtgttgaatggactgaacaaaccatgagtgattatttggaaaatccaaagaaa
tatattccaggtactaaaatggcttttggtggtttaaagaaaccaaaggacagaaacgat
ttagttacttatttgaagaaagctacttcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system