KEGG   Candida albicans: CaO19.9344Help
Entry
CaO19.9344        CDS       T00189                                 

Gene name
UBP15
Definition
putative ubiquitin-specific protease
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CaO19.9344 (UBP15)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CaO19.9344 (UBP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1382 aa AA seqDB search
MITNNNNSDNNTSSVDPSINVEELPDSKKQLTEDAIDPTQQQEQQPQLMEIDVETNQIIN
ENGFENHGVASPEVIDMTGDDDYDVDNHNNNNHNHHNNITIEDDDDNVVDDGDDEEDDDD
DDDDDDDDDDEIQIINSEPNSNVVAPKKFTRNFPLANDFNALAAKLMKPIEDYPTKEETY
YVWEIKDWAQLLKEEKVRSPKFKCGGFEWNILLFPRGNSQNNSLSIYMEPHPPVDENDKP
LDENWYVCAQFGLDIWNPAHPDAHLPNQSHHRFTKNETDWGFSSLIELRQLEQVNNPRNQ
SSMYAILENNKLNITGFVRVIDDSSTGVLWHSFLDYDSKANTGYVGLNNQGATCYLNSLL
QSYFTTKLFRKLVYEIPTDSKSAGVPLSLQRIFYLLTNSNDPVGTLELTKSFGWDSSDAF
TQHDVQELNRILMDKLETAMKGSKIEGALNDIFVGKMKSYIKCVNVPYESSRVEDFWDIQ
LNVKGFQTLKQSFQNYIEIEMLEGENKYQAGEEHGYQDAKKGVVFESFPPVLHLQLKRFE
YDFMVDDLVKIDDFYEFPDKIDLKPYLDEDLPEDVKNQNWNYKLHGVLVHQGSISNGHYY
AMIKPNANDDTWLRFDDDKVWKVNKTQVFQENFGATDLTQEQSQQMTRAEQQEHMVRRVT
SAYMLVYYRESELDKILPSDDNIVNSAIPEHIPKQIQFEIEEREKLEKARQEALYYITAK
LITSSTFNANLGFDLALDPTNNKFYDESLSGSACDPISLKVRKDSTFTQLVEAVGKTIKC
TNEKLFRLVAVCHRNNHTNRLDAPIGEEFQKSTISNVYSKIFNRKYDEMVFYVEELNKDI
KNVVQLVKNKDNGYIEPKDFTFEQVFSKIDAVGTDIHPNIEFKNTEEYSNYVTIVIKYFD
PVSQEIRGLSHITVAKEDKIDSIIDPIRELLGFKKNIALELYEELSQSKVEKIDSKLTFE
KHELNTGDIITVQIVNPGEINKNGKFKDLKDYYKFLLTRLHVNVRPFKAEIDEEDSDFIA
HEDDEDEDEENKGGETNNGTGYGGKGNGKDTEKDNKATNDEIQLAKNLSKSFDFWISTNY
SYQDLARDIAVKLNCDPLYLKIFILTAQGQRFPLKTSHHLSQLFPKTVSVNQIVEIEYEI
LNIPLKDYENLKAIKIHWLTTLLQYQVFEVLVPKRGTIGDVITKVLHKVNVSESDLPHLF
VWSGRNHKFHEMLKFDRALSTISDDVDLFCGIFPAEVEVLCDHDMYKRFTDKEIDETKLE
ESIHEEYLESIRWSKKLNLLPAFHFHKNNNYHHGIPFIFIVFPAETLNDTKERLRKKLRL
GKQAFDKVRLALADNNNRIKYLEDDSLVLFDEVAIKSYSLAIDNVDRNPKRQALFEKGIS
IK
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgataacaaataataacaatagtgataataatactagttcggtggatccatcaataaat
gttgaggagttaccggattccaaaaaacaattgactgaagatgcgattgatcctacgcaa
caacaagaacaacaaccccaattaatggaaatagatgttgaaaccaatcaaattataaat
gaaaatggatttgaaaaccatggtgtagccagtcctgaagtgattgatatgacaggtgat
gacgactatgatgttgacaaccacaacaataacaatcacaaccaccacaacaatatcacc
attgaagatgatgacgataatgtggttgatgatggtgacgacgaggaagacgacgacgac
gacgacgatgatgatgatgatgatgacgatgaaatacaaataattaattcagaacctaat
agcaatgtcgttgctccaaaaaagtttactcgtaatttcccactagctaatgattttaac
gctcttgcagccaaactaatgaaacctattgaagactatcccacaaaagaagaaacctat
tatgtttgggaaataaaggattgggcacaacttttaaaggaagaaaaagtccgatcacca
aaatttaaatgtgggggatttgaatggaatattttattgtttcctcgtggtaactcacaa
aataatagtctatcaatatatatggaacctcatccaccagttgatgaaaatgataaacca
ttagatgaaaattggtatgtttgtgctcaatttggattggatatttggaatccagctcac
ccagatgctcatttaccaaatcaaagtcatcatcgatttactaaaaatgaaactgattgg
gggtttagttcattaatagaattgagacaattagaacaagtcaataatccaagaaatcaa
tcgtcaatgtatgccattttggaaaataataaattaaatatcactgggtttgttcgagtt
atagatgattcttctaccggggtattatggcattcatttttagattatgattctaaggca
aatactggatacgttggtttaaataatcaaggagctacatgttatttgaattcattatta
caaagttatttcacaactaaattatttagaaaattagtgtacgaaatccccaccgatctg
aaatctgcaggagtacctttgtcattacaaagaattttctatttgttgaccaattcaaat
gatccggtggggacgttagaattgacaaaatcatttggttgggactcgtcagatgcattc
acccaacatgatgtacaagaattgaatcgtattttgatggataaattagaaactgctatg
aaagggtcgaaaattgaaggtgcattaaacgatatatttgtggggaaaatgaaatcttat
attaaatgtgtaaatgttccctatgagtcgtcacgggtggaagatttttgggacattcaa
ttgaatgttaaaggtttccaaactctcaaacaatcatttcaaaattatattgaaattgaa
atgttggaaggtgaaaataaataccaagcaggtgaagaacatgggtatcaagatgccaaa
aagggggttgtatttgaatcattcccaccagtattgcatttacaattgaaacgtttcgaa
tatgattttatggttgatgatttagttaaaattgatgatttttatgaattccccgataaa
attgatttgaaaccataccttgatgaagatttaccagaagatgtgaaaaaccaaaattgg
aattataaattgcatggtgtgttggtgcatcaaggtagtatttccaatggtcattattat
gccatgatcaaaccaaatgctaatgatgatacttggttaagattcgatgacgataaagtt
tggaaagttaataaaactcaagttttccaagagaattttggtgctactgatttgacacaa
gaacaatcacaacaaatgacaagagctgaacaacaagaacatatggtgagaagagtaacg
tcggcatatatgttggtttattatcgtgaatctgaattagacaaaattttaccaagtgat
gataacattgtcaattctgccattcctgaacatatccccaaacaaattcaatttgaaatt
gaggaacgtgaaaaattggaaaaggcaagacaagaagccttgtattatataactgccaaa
ttgataacttcatctacattcaatgccaatcttggatttgatcttgccttggatccaacg
aataataaattttatgatgaatccttgagtggtagtgcatgtgaccctatatcgttgaaa
gtaagaaaagatagtacatttactcaattggttgaagcagtgggcaaaacaattaaatgt
actaatgagaaattatttagattagttgccgtttgtcatagaaataaccataccaataga
ttggatgctcccattggtgaagaatttcaaaaatcaacgataagtaatgtttattcgaaa
atatttaatcgaaaatatgatgaaatggttttttatgttgaggaattgaataaagacatt
aagaatgttgttcaattggtgaaaaataaggataatggttacattgaacctaaagatttt
acatttgaacaagtgtttagtaaaattgatgctgttggtactgatattcatccgaatatt
gaatttaaaaataccgaagagtattctaattatgttactatagttatcaaatattttgat
cctgtatcacaagaaattagaggattatcacatattactgtggccaaagaagataagatt
gattcaattatagacccaatccgtgaattacttggatttaagaaaaatatcgctttagaa
ttgtatgaagaattatcacaatcaaaagttgaaaagattgattctaaattaacttttgaa
aaacatgaattgaatactggtgatatcattactgttcaaattgtcaatccaggtgaaatc
aataaaaatggtaaatttaaagatttgaaagactattataaatttttattaactagattg
catgttaatgtcagaccatttaaggcagaaattgatgaagaagattctgatttcatagct
catgaagacgatgaagatgaagatgaagaaaataaaggaggtgaaactaacaatggcact
ggttatggtggtaagggaaatggaaaagatactgaaaaagataataaagctacaaatgat
gaaattcaattggctaaaaatttgagtaaaagttttgatttttggatttcgacaaattat
agttatcaagatttagcaagagatattgctgttaaattaaattgtgatcctttatattta
aaaatatttatattaactgctcaaggtcaacgattcccattaaagacaagtcatcattta
tctcaattattccccaagacggtatcagtcaatcaaattgttgaaattgaatatgaaata
cttaatattccattaaaagattatgagaatttgaaagccattaaaatccattggttaacg
acattattacaatatcaagtatttgaagttttagttcctaaacgtggaactataggtgat
gttattactaaagttttacacaaggttaatgtatcggaatcggatttacctcatttattt
gtttggtcaggacgaaatcataaatttcatgagatgcttaaatttgatagggcattaagt
acaatttctgatgatgttgatttattttgtgggattttcccagctgaagttgaagtatta
tgtgatcatgatatgtataaaagatttactgataaagaaattgatgaaacaaaattggaa
gaatcaattcatgaagaatatttagaaagtattagatggagtaaaaaattaaatctttta
ccagcatttcattttcataaaaataataattatcatcatggaattccatttatttttata
gttttcccggctgaaacgttaaatgatacgaaagaacgattaaggaaaaaattaagatta
ggaaaacaagcatttgataaagttagacttgcattagctgataataataatagaatcaaa
tatttggaagatgattcattggtattgtttgatgaagttgccattaaactgtatagtttg
gctattgataatgttgatagaaatcctaaacgtcaagcattatttgaaaaagggatttcc
atcaaataa

DBGET integrated database retrieval system