KEGG   Candida albicans: CaO19.9459Help
Entry
CaO19.9459        CDS       T00189                                 

Definition
similar to C terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in nutrient-related growth control; frameshifted from upsteam TOR2 CDS (CaP19.9461); rest of TOR2 (CaP19.9830) in Ctg19-20143
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1369 aa AA seqDB search
MLNDMASRIIHPILRILGQGNIDLRESCINTLTYMLVQLGPEFTVFIPVIKKTLLQKNIH
AIKFEQLVGKLIGGDPLPLHLDIYKDYDYSLYDIADTDMPSKKLPVNQASLKAAWDASQR
RTKEDWQEWIGRLSKELLLQSPSHAIRACAGLASDYYPLAKDLFNASFASCWSELYSQHK
EELVESFCIALSSPSNPPEIHQTILNLAEFMEHDDKPLPMSISTLGQYAQRAHAFAKALH
YKELEFYDQPTTPTIESLISINNQLQQSDAAIGILKHAQLHHDLQLKETWYEKLQRWDDA
LKAYNEREKIEPENMEITIGKMRCLHALGEWEQLSELARSKWDNSSSEIKRSVAPLAAAA
AWGLSQWDRMDACIKVMKAESPDKAFFNAILSLHRNNFDDASVHILKARDLLVTEITALV
SESYNRAYGVVVRVQMLAELEEIIKYKCLPSGSEKRAVMRKTWNTRLLGCQRNVDIWQRM
LKVRALVIKPKQDMDMWIKFANLCRKSGRLNLAEKSLNLLLEEGSPENPSRAPPQVVYAQ
LKYMWAKGQRPEALRHLVDFTTRMSQDLGLNPNDLITQPLPSEGPGIPKHVEEYTKLLAR
CFLKQGEWQIALNSNWRSETSEIILGAYLLATHFDNKWYKAWHNWALANFEVISLYTSQN
TSANNKIEILQDERNGSTEDGHSELKRAEQQKQQQQQQQQQQQQANIIPIEAVQRHVIPS
IKGFFHSIALSNSNSLQDMLRLLTLWFKFGGIPEAAKAMTEGFNMVKIDNWLEVVPQLIS
RIHQPNEIVSRSLFALLTDLGKAHPQALVYPLTVAITSESTSRKKAAQSIIEKMRVHSPS
LVDQAELVSRELIRVAVLWHEQWHDALEDASRFFFGEHNTEKMFETLEPLHQMLQKGPET
MREQAFANAFGRELTDAYEWVLNFRRTKDITNLNQAWDIYYNVFRRVSKQVQSLASLELQ
YVSPDLKHAQDLELAVPGTYQAGKPVIRIIKFDPTFSIISSKQRPRKLSCRGSDGKDYQY
ALKGHEDIRQDNLVMQLFGLVNTLLVNDPECFKRHLDIQQYPAIPLSPKVGLLGWVPNSD
TFHVLIKGYRESRSIMLNIEHRLLLQMAPDYDFLTLLQKVEVFTSAMDNCKGQDLYKVLW
LKSKSSEAWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEA
AILREKYPERVPFRLTRMLNYAMEVSGIEGSFRITCEHVMRVLRDNKESLMAILEAFAYD
PLINWGFDFPTKALAESTGIRVPQVNTAELLRRGQIDEKEAVRLQKQNELEIRNARAALV
LKRITDKLTGNDIKRLRGLDVPTQVDKLIQQATSVENLCQHYIGWCSFW
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgatatggcatccagaataatccatccaattttaagaattcttggtcaaggg
aacattgaccttcgtgagtcatgtataaatactttgacgtacatgttggttcagttgggt
cctgagtttactgtttttatccccgtgatcaaaaagactttgttgcaaaaaaacatacac
gcaattaagtttgagcaattggttggaaaattgattggtggagacccgttaccactacac
ttggatatttacaaagattatgactatagtctttatgatattgctgatacggatatgcca
tctaaaaaattacctgtaaatcaagcatctttaaaggcagcctgggatgcaagtcaacga
agaactaaggaagattggcaagagtggattggtagattgagtaaggaactcttgcttcaa
agtccttctcatgctatcagagcttgtgccgggttggcatcggattattacccacttgca
aaagacctttttaatgctagttttgctagttgctggagtgagttatattctcagcacaag
gaagaattagtggaatcattttgtattgcactttcatcaccaagtaatcctccggaaata
catcaaactatattgaatcttgctgagtttatggagcatgatgataaaccacttccgatg
tcaatttctacattggggcaatatgcacaacgtgcccatgcgtttgccaaggcattgcat
tataaggagttggagttttatgatcaacccacaacgcctacaatcgagtcattgatcagt
attaataatcaattgcaacaatcggatgctgccataggtattttgaaacatgctcagttg
caccatgatttgcaattgaaggaaacttggtatgaaaaattgcaacgttgggacgatgct
ttgaaagcatacaatgaaagagaaaaaattgaacccgagaatatggagattactattggt
aaaatgaggtgtctacatgctttaggtgagtgggagcaactatccgaactagctcgaagc
aaatgggataattcatctagcgaaatcaaaagaagtgttgcaccgcttgcagctgcagct
gcttggggtttgagtcaatgggacagaatggatgcatgtattaaagtcatgaaggctgaa
tcacccgataaagcgtttttcaatgctatcttaagtcttcacagaaataactttgacgat
gcttcggtgcacattttgaaagcaagagatttgcttgtgacagaaatcactgctttggtg
agtgaaagttacaacagagcttatggagttgttgtccgtgttcaaatgcttgcagagttg
gaggaaattatcaaatacaaatgtttgccgctgggatctgaaaagcgagctgtgatgcgc
aagacttggaatacaagattattgggatgccaacgaaacgtagatatatggcaaagaatg
ttgaaggtcagagcgttggtgatcaaaccaaaacaagatatggatatgtggattaaattt
gctaatttgtgcagaaagtcaggaagattgaatttagcagagaaatccttgaatttgttg
ttggaagaaggatctccagaaaatccatcaagagctccccctcaagtcgtttacgcccaa
ttgaagtatatgtgggccaagggccagaggccagaagctttacgtcatttagtagatttc
actactagaatgtcccaagatctagggttgaatccaaatgatttaattactcaaccgtta
ccatcggagggtcctggtatcccaaaacatgttgaagaatacactaaattgttggcaagg
tgtttcttgaagcaaggtgaatggcagattgcattgaatagcaattggagatcagagact
tcagagattattttgggtgcatatttgttggccacccattttgacaataagtggtataag
gcttggcataattgggcattggcaaactttgaggttatatcattgtacactagtcaaaac
acatctgccaataataagatagagattttacaggacgagcgcaatggatctacggaggat
ggccattcggaattgaaaagagctgagcagcagaaacaacaacaacagcagcagcagcag
cagcaacaacaagctaatattataccaatcgaagctgttcaaagacatgtcataccatct
atcaaaggattctttcattctattgctttatccaattcaaactctcttcaggatatgtta
agattacttacattgtggttcaagtttggtggaattcctgaggcagccaaggccatgaca
gaagggttcaatatggtaaaaattgataactggttggaagtagtgccacaattgatttct
cgaattcaccaacctaatgaaatagtgagtcgctccttatttgcgttattgactgatttg
ggcaaagctcatccacaagcattggtttatcctttgacagttgctattacttccgaatca
acgagccgtaaaaaggcagctcaatccattattgaaaaaatgcgagtacattctcctagc
ttggtggatcaagcagaattagtgagtcgagaactcatccgagttgcagttttatggcac
gaacaatggcacgatgctttggaagatgctagcaggtttttctttggtgaacacaacaca
gaaaagatgtttgaaacattggaaccattacatcaaatgttgcaaaagggaccagaaacg
atgagggaacaagcctttgcaaatgcttttggcagggagttgacagatgcatacgagtgg
gtgctcaactttagaagaactaaagacataaccaatttgaatcaagcatgggatatatac
tacaatgtctttagaagagtaagcaaacaggtgcagctgttagctagtcttgagttgcag
tatgtatctccggacttaaagcatgctcaagatttggaattggctgtaccaggtacttac
caagcaggcaaacctgtgatcagaataatcaaatttgatcctactttttcgattatttca
tctaaacaaagaccgagaaaattatcgtgcagaggaagtgatggtaaagactaccaatat
gcgttgaaaggacatgaagatatcagacaagataacttagtgatgcaattgtttggtttg
gttaatacgttgttggtaaatgatccggaatgtttcaagagacatttggatatacaacaa
tatcctgctattccattatcaccaaaagtgggattgcttggttgggttccaaatagtgac
actttccatgtattgatcaaaggctatcgcgaatcaagaagtataatgttgaatattgaa
cacaggcttttgttgcaaatggcacctgattatgatttcttgacattattgcaaaaagtt
gaagtgttcacaagtgcaatggataattgtaagggacaggatttgtacaaagtgttatgg
ctcaaatctaaatcatccgaggcgtggttggaccgtagaacaacatacacgagatcatta
gctgtaatgtctatggttgggtatatattaggtttgggggataggcacccatcaaatttg
atgttggaccgtattactgggaaagtcatccatattgatttcggagactgttttgaagca
gcaatattacgtgagaagtatccagagagagttccgtttagattgacgagaatgcttaat
tatgccatggaagttagtggaatagagggctcgttcagaatcacatgtgaacatgttatg
agggtgttgcgtgataataaagagtctttaatggcaatattagaggcctttgcttacgat
cccttgataaattgggggtttgatttcccaacaaaggcgttggctgaatcaacgggtata
cgtgttccacaagtcaacactgcagaattattacgcagaggacagattgacgaaaaagaa
gctgtaagattgcaaaagcaaaatgaattggaaataagaaacgctagagctgcattagtg
ttgaaacgtattaccgataagttaactggtaacgatatcaaacggttgagaggattagat
gtgcctactcaagtcgataaattgattcaacaagccaccagtgttgagaatttgtgtcag
cattacattggttggtgttcgttttggtag

DBGET integrated database retrieval system