KEGG   Candida albicans: CaO19.9501Help
Entry
CaO19.9501        CDS       T00189                                 

Definition
potential aldose epimerase; similar to S. cerevisiae YMR099c
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CaO19.9501
Enzymes [BR:cal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CaO19.9501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 299 aa AA seqDB search
MPVEELEDRVIITDPNDSTNRATILKFGATVVSWKNNNQEKLWLSEGAHLDGSKAVRGGI
PLVFPVFGKQKDSNHPTFKLPQHGFARNSTWEFLGQTQESPITVQFGLGPENVDPETLKL
WNYDFTLILTVSLTKDKLVTSIDVENTGKEAFEFNWLFHTYYRIHDITDTLVTNLIDQQC
YDQLIGESYIEKAPVISFHEEFDRIYSKVSLEKSIQVVDKGQVLFNLHRKNLPDSVVWNP
WTKKAEGMADFQPKSGFHQMVCVEPGHVNSMVSLPAGGKWSGGQEITIGGEIKVQANIY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgaagagcttgaagaccgtgttatcattactgatccaaatgactcaactaac
agagccaccattttgaaatttggtgctactgtagtttcttggaaaaacaataatcaagaa
aaattgtggttatcagaaggtgctcatttagatggaagtaaagccgttagaggtggtatc
ccattagttttcccagttttcggtaaacaaaaagattcaaatcatccaactttcaaatta
cctcaacatggatttgctcgtaattcaacttgggaattcttgggacaaactcaagaaagt
cctattacggttcaatttggattaggtccagaaaatgttgatccagaaactttgaaatta
tggaattatgatttcactttgattttaactgttagtttgactaaagataaattggttact
tcaattgacgtggaaaacactggtaaagaagcatttgaatttaattggttgttccataca
tattatagaatccatgacatcaccgatacattagttaccaatttaattgaccaacaatgt
tacgatcaattgattggtgaatcatatatcgaaaaggcaccagttatcagtttccatgaa
gaatttgatagaatttattcaaaagtcagtttggaaaaatccattcaagtcgttgataaa
ggtcaagttcttttcaatcttcatagaaaaaacttgcctgattccgttgtatggaatcca
tggactaagaaagctgaaggtatggctgatttccaaccaaaatcagggtttcatcaaatg
gtctgtgttgagccaggtcatgttaactcaatggtctctttaccagctggtgggaaatgg
tcaggtggtcaagaaatcactattggcggtgagattaaagttcaagctaatatttattag

DBGET integrated database retrieval system