KEGG   Candida albicans: CaO19.9575Help
Entry
CaO19.9575        CDS       T00189                                 

Gene name
UBP9
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CaO19.9575 (UBP9)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CaO19.9575 (UBP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 700 aa AA seqDB search
MGNSETDNLLFGDGSDKIFGMENFGNTCYCNSILQCLYYTESFRLKLIQHNQTKHDPKLI
VTGVKPHSFTSKYEQLVQKKLREQGGKSASSNSNTATEERPKQGSRKGSIFGIKFNNSVN
TSTTTVPVAIDDSKKPYMKYIDKAKDCEALSLEQRIKISKSPEFQKLDILVTRPSINQTA
KKPVDDDNRNDYSQSSSMLLNDQPQQTIQEGSISTTSSAIIVGIPLPESNLNTPINPFNS
DPSGDQRKRSALINGPIINLDTSLQLPSEQQEDTALLYALKDLFESMVENKSTIGVVSPT
YFIQKLKEKNFFVRQNNMHHDAHEFFNYLTNEIIESLNKEGFTNDKNWCSDIFRGLITNE
TKCLSCEKITSKQELFLDLSIDIPPGESAFSLSYALNNFSKSETLTHQNKFYCNTCSSLQ
EAVKTIKLKKLPEVLVINLKRFKYDEQMDKMVKLFDSINYPFKLRLFNTTDDESLTDLLY
ELYALVIHIGGGPMHGHYVSLCKIKAGLWLLFDDETVELVEDSYVMRFFGNGPGLASAYI
LFYRQAKYDPEFGFNPEDIYNGNDDYSFKQTEDESSTFATSVNNDYLDTKSEASSIASFN
VNEATKKTNVFKNFKFDKDDKPPAPISRSNSMNANLAPGAPIKEVKEKKSWVGNLKRRNT
ETSNSGNIPPMERKPSTSSTTSGNGNTTERRRSIFGFKRK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggggaacagtgaaaccgacaatctattattcggtgatggatcagataaaatatttggg
atggagaattttggaaacacatgctattgcaattctatactacaatgtttatactacacg
gaaagtttcagattgaaactaatccaacataaccaaacaaagcatgatcctaaacttatt
gttacaggagtcaaacctcatagtttcacaagcaaatatgaacaacttgtacaaaagaaa
ctacgagaacaaggagggaagctggcatccctgaattcaaacacggctactgaagaaaga
cccaaacaaggtagtagaaaaggatccatttttggtattaaatttaacaattcagtcaat
acctcaactacaacggttcctgtagctattgatgattcaaaaaaaccatatatgaaatat
atcgacaaagccaaagactgtgaggctctatcgttggaacaacgcataaaaataagcaaa
tctccagaatttcaaaagttagatatcttggtaacaaggccgtcaattaatcaaacagct
aaaaagcctgttgacgacgacaatagaaatgattattcacaaagctcatctatgctactc
aatgatcaaccacaacaaactatacaagaagggtctattagcactacttctagtgctata
atagttggaataccacttcccgaatctaacttgaacacaccaattaacccattcaattcg
gatcccagtggcgatcagagaaagagatcagccttgatcaatggaccaattatcaaccta
gatacatcattgcaacttcccagcgagcaacaagaagatacagccttgctatatgcgttg
aaggatttatttgaaagtatggttgaaaacaaatctaccattggagtagtatcaccaacc
tactttattcagaaactcaaagaaaagaacttttttgttcgtcagaacaatatgcatcat
gatgctcatgagtttttcaattatttgaccaatgaaatcattgaaagtttgaacaaagag
ggtttcactaacgataaaaactggtgcagtgatattttccgaggtctaatcaccaatgaa
accaaatgcttatcttgtgaaaagatcacatctaaacaggaactatttctagatttgtcc
attgatataccaccaggagaaagtgctttttcattaagttatgcattaaataatttctca
aagtcagaaactttaactcatcagaataagttttattgcaacacctgttcttccttacaa
gaggcagtgaaaacaataaaactcaaaaaattgcccgaagtgcttgttatcaatttgaaa
agattcaagtacgatgaacaaatggacaagatggttaaactttttgattccataaattac
cctttcaagttgcgattgtttaacactactgatgatgaatcgttgacggatttgttgtat
gaattgtatgcattagttattcacattggtggtggaccgatgcatggacattatgtttcg
ttatgcaaaatcaaagctggattatggttattatttgatgacgaaactgttgaattggtg
gaggattcatatgtaatgaggttttttggtaatggacccggtctagcaagtgcttacatt
ttattctacaggcaggcgaaatacgatcctgaatttggttttaatcctgaggatatttac
aatggcaacgacgattactctttcaagcaaacagaggacgaatcaagcacatttgcaact
tcggttaacaatgactatcttgataccaaatcagaagcttcttccattgcctctttcaat
gtgaatgaggcgactaaaaagacaaacgtattcaaaaatttcaaatttgacaaggatgac
aaacccccagctccaatttctcgtagcaatagtatgaatgctaaccttgctccaggtgct
cccattaaagaggttaaagagaagaaatcttgggttggtaatttgaagagaaggaatacc
gagaccagtaatagtggaaatataccaccgatggaaagaaaaccttccacaagtagcaca
acatctggaaatggtaacaccactgaaagaagaagaagtatatttgggtttaaaaggaag
tag

DBGET integrated database retrieval system