KEGG   Candida albicans: CaO19.9634Help
Entry
CaO19.9634        CDS       T00189                                 

Gene name
SAS2
Definition
involved in silencing at HMR
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 352 aa AA seqDB search
MSVTTTTNIIKASPKRKTKTDTKDQDNSYYGQLNKRNINKVTFGKYEFPTWYGNAAYFYP
HDLSHSSLGYEYANKVASEGSIARKIHKKDIFDENLHEFWLDHLFVCEYCFKYTSNETIL
NQHVTACTYNRKRPSKGKLLYHDQANGYIIREVRGFQDPLFCQNLCLFGKLFLDDKSVYY
NIDHFDFYIVFGKDDSSYIPMGFFSKEVLSYDNDNNLACICVFPPFQRRHLGSLLIEFSY
QLAAVTPGQLKSSGPEFPLSPYGKVTYLRFWSKRLATKIHELQGSFTLSHLSKETGFRKE
DILLTLEYMQILVTDDLGNVTLSLERLENWCSQNKVVPGVDINILNSECLIL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctggtaactactacaacaaacattataaaagcctctcccaaacggaaaacgaaaaca
gacaccaaagatcaagataattcttactatggacagttgaacaaacgaaatatcaataaa
gtcacatttggtaaatacgagtttcctacatggtacggaaacgcagcatatttctatccc
catgatctatcgcattcaagcttaggttatgaatatgccaacaaagtagcttctgaagga
tcaattgcccgaaaaatccataaaaaagatatatttgatgaaaatttacacgaattttgg
ctagatcatttatttgtttgtgaatattgtttcaagtacacttccaatgagacaattttg
aatcaacatgtaactgcatgcacatataatagaaaaagaccaagtaaaggtaaattgttg
taccatgaccaggccaatggctatataattcgagaagtacgagggtttcaggatccttta
ttttgtcaaaacctatgcttgtttggaaaattgtttcttgacgataaatcggtttattat
aatatagatcattttgatttttatattgttttcggtaaagacgattcctcctatattccc
atggggtttttttccaaggaagtcttatcgtacgacaatgataataacctagcctgtatt
tgtgtattccccccgtttcaaagaagacatttgggttcattgttgattgaatttctgtat
caattggctgcagttactccaggacaacttaaaagcagtggcccagaattcccactttca
ccatatggcaaagtgacatatttgaggttttggtcaaaaagactagcgacgaaaatccac
gaactacagggatcatttacattgagccatctttcaaaagaaaccgggttcagaaaagaa
gatattctactaacacttgaatacatgcagatactagttacagatgatttgggaaatgtg
acactttcacttgaacgacttgaaaattggtgctcacaaaacaaggttgttcccggagtc
gacataaatatcttaaattcagaatgtttaatactatga

DBGET integrated database retrieval system