KEGG   Candida albicans: CaO19.9662Help
Entry
CaO19.9662        CDS       T00189                                 

Gene name
URO99
Definition
Urate Oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cal  Candida albicans
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CaO19.9662 (URO99)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CaO19.9662 (URO99)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     CaO19.9662 (URO99)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 303 aa AA seqDB search
MQSELYSSTYGKGNVKFLKVKKDPSNPTVQDVLEANVQVLLRGKFDESYTKADNSSIVPT
DTVKNTILVEAKTTDVWPIERFAAHLAKHFTTKYGHVDGIEVTIIQAKWSKIKLEGKEHA
HSFKHEGPETRRTYLNYDKHTKKLQLSSSIKDLTVLKSTGSMFYGYNVCDYTTLQPTKDR
ILSTDVDASWTFDPTQIATLDDILSQPKLFDTTYNTARDVTLELFCKENSPSVQSTMYNM
SHKILETVKQVGTVSYVLPNKHYILFNLEWKGIKDNKDLFYPAPDPNGLIKSTVGRKGDK
AKF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgaattatactcctcaacctacggtaaaggtaatgtcaaatttttaaaggtc
aaaaaagatccatcaaacccaactgtgcaagatgttcttgaagctaatgtccaggttttg
ttgagaggtaaatttgatgaatcgtacaccaaagccgacaactcgtcgattgttcctact
gatacggtcaaaaacacgattttggttgaagccaaaaccactgatgtttggccaattgaa
aggtttgctgctcatttagctaaacatttcaccactaaatacggacatgttgatgggatt
gaagttaccattattcaagccaaatggtcaaagattaagttagaaggtaaggaacatgct
cattcattcaagcacgaagggccagaaactagacgtacttatttgaactacgacaagcac
accaagaaattacaattgtcgtcctcaatcaaggacttgacggtgttgaaatcaactggg
tccatgttttatgggtataatgtgtgtgactacaccactttgcaacctaccaaagataga
atcttgtcgactgatgttgatgcttcgtggacatttgatccaacacagatcgctacttta
gacgacatattatcgcaaccaaaattgtttgacaccacatataatactgctagagatgtc
acattagaattgttctgtaaagaaaattctccttcggtccaatccaccatgtacaacatg
tctcacaagattttggaaaccgtaaagcaagttggtactgttagctatgttttaccaaat
aaacattacatcttgttcaatttggaatggaagggcattaaagacaacaaagacttgttc
tacccagcacctgatccaaatggtttgattaaaagtactgttggtagaaaaggtgacaaa
gccaagttttag

DBGET integrated database retrieval system