KEGG   Candida albicans: CaO19.9807Help
Entry
CaO19.9807        CDS       T00189                                 

Gene name
RFA2
Definition
subunit 2 of replication factor RF-A
Orthology
K10739  
replication factor A2
Organism
cal  Candida albicans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CaO19.9807 (RFA2)
   03420 Nucleotide excision repair
    CaO19.9807 (RFA2)
   03430 Mismatch repair
    CaO19.9807 (RFA2)
   03440 Homologous recombination
    CaO19.9807 (RFA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 272 aa AA seqDB search
MSDFEYDNNNTGAFGNISQGGFNTEHAGSSQRQTTTQVRQSLTPVTIKQINDATQPVPDG
EFKVNNVELNMISFVGVVRNVENTNASIAVTIEDGTGSIDVRKWVDETISSAEEDFEKYN
EMKGKYVYVGGSLKQFNNRKTVQNASISLITDSNQIVYHHLSAIEHHLKAQGITAADAAS
AGAGQATNSTASAGSGLFMDNPTSLSKDTGSLTDQVIAVLKEASRTMPDGVPVDYVAEKL
SITKEESQFQLLKLNDEGKAYAGYDDNSYLVI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttgaatacgataataacaatactggagcattcggcaatatatcccaaggt
ggtttcaatactgaacatgctggatcgtctcagcgtcaaacaacaacccaagttagacaa
agtttgacacctgtaaccatcaaacaaattaatgatgcaacacaaccagtcccagatggc
gagttcaaagtaaataatgtcgaattaaatatgatttcatttgttggtgttgtacgtaat
gttgaaaatacgaatgcatctattgcagtaactattgaagatggcactgggtctattgat
gttcgtaaatgggtggatgagactatcagctcggccgaagaggactttgaaaagtataat
gagatgaaaggtaagtatgtttatgttggtgggtcattgaaacagttcaacaatcgtaaa
actgtccagaatgcttctatttctttaataactgacagcaatcaaattgtatatcaccat
ttgagtgcaattgaacatcatttgaaagctcaaggcattacagcagctgatgctgctagt
gctggtgctggacaagcaacaaattccactgccagtgctggtagtggattgtttatggat
aatccaactagtctctcgaaagatacaggatcacttacggatcaagtgatagccgtattg
aaagaagccagcagaaccatgccagatggtgtcccagttgactacgttgctgaaaaattg
agtattactaaagaggaaagtcagttccaacttttaaaattgaatgatgaaggtaaagct
tatgctggttatgatgacaacagttatcttgtgatttga

DBGET integrated database retrieval system