KEGG   Candida albicans: CaO19.9817Help
Entry
CaO19.9817        CDS       T00189                                 

Gene name
TPK2
Definition
protein kinase A; similar to S. cerevisiae TPK2 (YPL203W) cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cal  Candida albicans
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:cal04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 444 aa AA seqDB search
MVNLLKKLHITKSHQSNQSNSDSNSLNSNTSMDNHQQQQQLQHQQYQQQFQQPQQQLYPG
EQIVHPAAAQTGQNTTNVTAVSSSNITQSATSSLHSQQLQHVDVSKSAAEEAIRRSLLPE
RSTVSKGKYSLTDFSIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQVVKMKQVEHTN
DERRMLKLVEHPFLIRMWGTFQDSKNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE
VTLALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAKEVSTVTWTLCGTPDYIAPEV
ITTKPYNKSVDWWSLGVLIFEMLAGYTPFYDSTPMKTYEKILAGKIHYPSFFQPDVIDLL
TKLITADLTRRLGNLINGPADIRNHPWFSEVVWEKLLAKDIETPYEPPITAGVGDSSLFD
HYPEEQLDYGSQGEDPYASYFLDF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatcttttaaagaaacttcacatcaccaagctgcatcaactgaatcaatccaat
tcggacagtaattccttaaactcaaacacatcaatggacaatcatcaacaacaacagcag
cttcagcatcagcaatatcagcaacaatttcaacaaccgcagcaacaactttatccaggc
gaacaaatagttcaccctgctgcagcccaaactggacaaaatactacaaatgtaacagca
gtgtcgagctccaacattacccaatctgctacctcatcactccattcacagcaattgcag
catgtagatgtttccaaatcggctgctgaagaagccatcagaagatcgttgttgcctgaa
cgttctactgtttcaaaggggaaatactctttgactgatttctcaattatgagaactttg
ggaacaggttcctttggtagagtacatttagtgagatcagttcacaatggtagatattat
gctatcaaagttttgaagaagcatcaagttgtgaaaatgaagcaagttgaacacacaaat
gatgaaagaagaatgttgaagttggttgaacatccatttttgattagaatgtgggggact
ttccaagattccaaaaatttatttatggttatggactatattgaagggggagagttattt
tcattgttaagaaagtctcagagatttcccaatccagtagccaagttttatgctgcagag
gttaccttggctttggagtatttgcacagtcatgatattatctatcgtgatttgaaacca
gaaaatatattattggatagaaatggtcatataaagattacagattttggatttgccaaa
gaagttagtaccgttacatggacgttatgtggtacccccgattatattgccccagaagtc
ataacaaccaaaccctataacaagtcggtggactggtggtcgttgggggtattgattttt
gaaatgttggcaggttacactccattttatgattcgactccaatgaaaacttatgaaaaa
attttggcaggcaaaatacattacccaagtttttttcaacctgatgtgattgatttgttg
actaaattaataactgctgatttgacaagaagattgggtaatttgatcaacggaccagca
gatatcagaaatcatccctggtttctggaagtggtatgggagaaattgttggcaaaggat
attgaaactccttatgaaccaccaatcacagctggggttggtgattcgtcattgtttgac
cattatccagaagaacaattagactacggaagccaaggagaagatccttatgctctgtat
ttccttgacttttga

DBGET integrated database retrieval system