KEGG   Candida albicans: CaO19.9827Help
Entry
CaO19.9827        CDS       T00189                                 

Gene name
RPA12
Definition
RNA polymerase I subunit A12.2
Orthology
K03000  
DNA-directed RNA polymerase I subunit RPA12
Organism
cal  Candida albicans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CaO19.9827 (RPA12)
   00240 Pyrimidine metabolism
    CaO19.9827 (RPA12)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    CaO19.9827 (RPA12)
Transcription machinery [BR:cal03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     CaO19.9827 (RPA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 123 aa AA seqDB search
MSVVGSLIFCNYCGNLLDSHSSSSEIKCTVCSAAYPKSKFANLKVVTKSSDDAFPSKLKS
ARSVVKTSLKKDELDEGATIKEKCPKCGNEEMQYHTLQLRSADEGATVFYTCTNCGYRFR
TNN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagttggatctttaatattttgtaactattgtggtaatttactagattctcat
agctcatcatctgaaataaaatgtacagtctgctcagcagcttatcccaaatcaaaattt
gctaacttaaaggtcgtgacaaaatcatcagacgatgccttcccatcgaaattaaaactg
gctagatccgtagtgaagacttctttaaagaaggatgaactagacgaaggtgcaacaatt
aaagaaaaatgtcctaaatgtgggaatgaagaaatgcaatatcatactttacaattaaga
tctgcagatgaaggtgctacagtgttttatacatgcaccaactgtgggtaccgtttcaga
actaacaattag

DBGET integrated database retrieval system