KEGG   Candida albicans: CaO19.9827Help
Entry
CaO19.9827        CDS       T00189                                 

Gene name
RPA12
Definition
RNA polymerase I subunit A12.2
Orthology
K03000  
DNA-directed RNA polymerase I subunit RPA12
Organism
cal  Candida albicans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cal00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cal00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:cal03020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 123 aa AA seqDB search
MSVVGSLIFCNYCGNLLDSHSSSSEIKCTVCSAAYPKSKFANLKVVTKSSDDAFPSKLKS
ARSVVKTSLKKDELDEGATIKEKCPKCGNEEMQYHTLQLRSADEGATVFYTCTNCGYRFR
TNN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagttggatctttaatattttgtaactattgtggtaatttactagattctcat
agctcatcatctgaaataaaatgtacagtctgctcagcagcttatcccaaatcaaaattt
gctaacttaaaggtcgtgacaaaatcatcagacgatgccttcccatcgaaattaaaactg
gctagatccgtagtgaagacttctttaaagaaggatgaactagacgaaggtgcaacaatt
aaagaaaaatgtcctaaatgtgggaatgaagaaatgcaatatcatactttacaattaaga
tctgcagatgaaggtgctacagtgttttatacatgcaccaactgtgggtaccgtttcaga
actaacaattag

DBGET integrated database retrieval system