KEGG   Candida albicans: CaO19.9896Help
Entry
CaO19.9896        CDS       T00189                                 

Gene name
URA2
Definition
aspartate transcarbamylase similar to S. cerevisiae URA2 (YJL130C) pyrimidine biosynthesis enzyme
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
cal  Candida albicans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cal00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cal00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2216 aa AA seqDB search
MAQLSVPITPPMESTGDVLMTLETQDGIALQGYSFGAAKPAAGEVVFQTGMVGYPESITD
PSYEGQILVITYPLVGNYGVPDRELLDEDYEPALPKYFESNKIHIAGLVVAHYTEEYSHW
LAKSSLGKWLQEQGIPAIYGVDTRSLTKRLREKGSTLGRLAIQNSDYKSEEIISQSKSNP
QNWKKFFNVPEFDDPNVKNLVAKVSTDKPILYTPKKTNENIKLGKNGKPIRILAVDVGMK
YNQIRCFVRRGVELLVVPWDYDFTTEEYDGLFISNGPGDPAVMDKTVERLQKILKEGKTP
VFGICLGHQLLARATGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHGYAVDTATLSNG
WKELFVNANDGSNEGIYHESKPFFSVQFHPESTPGPRDTEFLFDVFIKSVVDFNQSGGVY
KQVEFPGGKLAENRAAHPKVDVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTV
LINPNIATIQTSKGLADKVYFLPVTPEFVRKVIKHERPDGIYCTFGGQTALSVGIALKDE
FEGLGVKVLGTQIDTVITTEDRELFASAMAEINEKCARSEACNTVKEAVDAANAIGYPLI
VRAAYALGGLGSGFADNEEELVALCNKAFATSPQVLVERSMKGWKEVEYEVVRDAFDNCI
TVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNP
FSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEIKNSVTKSTSACFEPS
LDYCVVKIPRWDLKKFTRVSALLSSSMKSVGEVMAIGRTFEEAIQKAIRSTDYHNLGFNK
TAALMSIDIDQELQTPSDQRLFAIANALSDGYSVDKVWKLTNIDKWFLNKLDGLIKFGNK
IASYGAKEDVPMSILRQAKQLGFEDRQIAKFLGSNEVAIRRLRKDAGIIPFVKQIDTVAA
EFPAFTNYLYVTYNADSSDVKFDDNGVIVLGSGVYRIGSSVEFDWCAVRAIRTLRENNVK
TVMINYNPETVSTDYDEADRLYFEPINLERVLDIYDLEQSSGVIISMGGQTSNNIALPLY
RQNVKILGTSPEMIDSAENRYKFSRMLDRIGVDQPAWKELTSIDEAEDFAEKVGYPVLVR
PSYVLSGAAMNTVYSKDDLASYLGQAVDVSPDYPVVITKYIENAKEIEMDAVAKDGKMIM
HVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIVEATAKIGKALDITGPYNIQFIAKDN
DIKVIECNVRASRSFPFVSKVVGVDLIEMATKAMLDLPIVPYPGERLPEDYCAVKVPQFS
FSRLAGADPVLGVEMASTGEVATFGKNKYEAYLKSLISTGFKLPKKNILFSIGSFKEKQE
LLPSIAKLHELGYKIFATAGTADFIKEHGIPVHYLEVLSKDEDQKSEYNLSQHLANNLID
LYVNLPSANRFRRPASYMSKGYESRRMAVDYAVPLVTNVKNAKLLVEAIARNISLEVSNR
DAQTSHGTAILPGLINITSFATSFDDFEQTTKESLAAGFTFNAFLPHTQAGASVTDYRSL
IDAIDAVGASAYTDYSVSIAASETNSQSVSDAADNAGSLFLPFNDFANSKVSALTAQFSS
WPNNKPIITDAKTTDLASVLLLASLYNRSIHITGVSSKEDLDLIKMAKEKTLQVTCDVAV
HSLFLSKDELDYPFLPNKQDQEYLWENLKDVDCFSIGVLPYLIAKASGTEIAPGMGIKEA
VPLLLTAVKAGKLTIGDIVSKFHDNPAKIFNLPKQDAQVVLDLDRFATVEPVYPEFSKLR
LRGAVERVSFHNETVVLDGSVLSQIALGKNEVVPRSRFGSTAGIPESPRLGNKRVSFSSD
MRRPSLAPETPEPQPAIFEKLGSELVSQPIAGSLGEIAALSDYIRHNNTFLRNNIISVKD
ITRSDLHSLFTVAQEMRLAVERQGVLDLLQGRVLATMFYEPSTRTSTSFDAAMQRLGGRV
VAVDHGSSSVKKGETLQDTIRTLSCYSDAIVLRHPSEESADIAAKYSPVPIINAGNGTKE
HPTQALLDLFTIREELGTVNGITVTFMGDLKYGRPVHSLCHLLRHYQVRVQLVAPKELQI
PAEIRQQLIDNNMLIAESEELTKEILARSDVLYCTRVQEERFADKEQYQRLKDTYIVDNK
ILSNAKQHMCVMHPLPRTNEIREEVDFDQRAAYFRQMRHGLFIRMALLAMVIGVDF
NT seq 6651 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattatctgttccaattactccaccaatggaatctactggtgatgtattgatg
actttggaaacccaagatggtattgctcttcaagggtattcctttggggctgcaaaacca
gctgctggtgaagttgttttccaaactggtatggttggctaccctgaatccatcactgat
ccttcttatgagggccaaatcttggttatcacctacccattagtaggtaattatggtgtt
ccagatcgtgaattactcgatgaggattatgaaccagcattacctaaatattttgaatcc
aataaaatccatattgctgggttagtggttgctcattatactgaagaatactctcattgg
ttagctaaatcttctttaggtaaatggttacaagaacaaggtattcctgctatttatgga
gttgataccagatctttaactaaaagattaagagaaaaagggtcaactttaggtagattg
gccattcaaaactctgattacaaatcagaagaaatcatttctcaatctaaatcaaatcct
caaaattggaaaaaatttttcaatgtcccggaatttgatgatccaaatgtgaaaaatttg
gttgcaaaagtatctactgataaaccaattttatatacccctaaaaaaaccaatgaaaat
attaaattgggtaaaaatggtaaaccaattagaatccttgctgttgatgttgggatgaaa
tataatcaaattagatgttttgttagaagaggagttgaattattggttgttccttgggat
tatgatttcaccactgaagaatacgatgggttgtttatttctaatggtcctggtgatcca
gccgttatggataaaaccgtggaaagattacaaaaaatccttaaagaaggtaaaacccca
gttttcggtatttgtttaggtcatcaattattagcaagagctactggtgcttccactttg
aaattgaaatttggtaatcgtggtcataacattccttgtacttccactatttctggtaga
tgttacattacttctcagaatcatggttatgccgttgacaccgccactttatcaaatggt
tggaaagaattatttgtcaatgccaatgatggatcaaatgaaggtatttaccacgaatcc
aaaccatttttctccgtccaattccacccagaatctactccaggtccaagagacaccgaa
ttcttatttgatgttttcattaaatctgtcgttgatttcaaccaatctggtggtgtttat
aaacaagttgaattcccaggtggtaaattggccgaaaacagagctgctcatcctaaagtc
gacgttaagaaagttttggttttgggatctggtgggttatctattggtcaagctggtgaa
ttcgattattctggttctcaagccattaaagctttgaaagaagaaggtatttacacagtt
ttaatcaatccaaatattgccactattcaaacttcaaaaggtttagccgataaagtttat
ttcttaccggttaccccagaatttgttagaaaagttattaaacatgaaagacctgatggt
atttactgtacttttggtggtcaaactgctttgagtgttggtattgccttgaaagatgaa
tttgaaggtttgggtgtcaaagttcttggtactcaaattgatactgttattaccactgaa
gatagagaattatttgcctccgccatggccgaaatcaatgaaaaatgtgccagatctgaa
gcttgtaacaccgtcaaggaagccgttgacgctgccaatgctattggttacccattgatt
gttagagctgcttatgctttaggtgggttaggttcaggttttgctgacaacgaagaagaa
ttggtggccttgtgtaacaaagcatttgccacttctccacaagttcttgttgaaagatcc
atgaaaggttggaaagaagttgaatatgaagttgttcgtgatgcctttgacaattgtatt
actgtttgtaatatggaaaattttgatccattgggtattcacactggtgattccattgtt
gttgctccttcacaaaccttgtcagatgaagattacaatatgttgagaactactgccgtt
aatgtcattagacatttgggtgttgttggtgaatgtaacattcaatatgccttgaaccca
ttctccaaggaatactgtattatcgaagtcaatgccagattgtctcgttcttcagcttta
gcttctaaagccactggttatccattagcttataccgctgccaaattgggtcttaacatt
ccattgaatgaaatcaaaaactctgttaccaaatcaaccagtgcttgttttgaaccatca
ttggattactgtgtggttaaaattccaagatgggatttgaaaaaattcactcgtgtctca
gcccttttgtcttcatcaatgaaatctgttggtgaagttatggccattggtagaactttc
gaagaagccattcaaaaagccatcagatctactgattaccacaacttgggtttcaacaaa
actgctgcattaatgtcaattgatattgatcaagaattacaaacaccatcagatcaacgt
ttgtttgccattgccaatgccttgtcagatggttattctgttgataaagtttggaaatta
accaatatcgataaatggttcttgaacaaattggacggtttaatcaaatttggtaacaag
attgcctcatatggtgccaaggaagatgttccaatgtcaatcttaagacaagccaaacaa
ttgggattcgaagatagacaaattgctaaattcttaggttctaacgaagttgccattaga
agattaagaaaagatgctggtatcattccatttgttaaacaaatcgatactgttgctgct
gaattcccagctttcaccaattatttgtatgtcacttacaatgccgattcttccgacgtt
aaatttgacgataatggtgttattgttcttggttctggtgtttacagaattggttcttct
gttgaattcgattggtgtgccgttagagccattagaactttgcgtgaaaacaatgtcaaa
acagtcatgatcaattataacccagaaactgtttccaccgattatgatgaagccgacaga
ttgtatttcgaaccaatcaacttggaaagagttttggatatttatgacttggaacaatct
tccggggttattatttctatgggtggtcaaacttcaaacaatattgccttaccattgtac
agacaaaatgtcaagattttgggtacatctccagaaatgattgactctgctgaaaacaga
tataaattctcaagaatgttggatagaattggtgttgatcaaccagcttggaaagaattg
acttctattgatgaagctgaagattttgccgaaaaagtcggttacccagttttggttcgt
ccttcatacgttttgtctggtgctgctatgaacactgtttattctaaagatgatttagct
tcatacttgggtcaagccgttgacgtttcaccagattatccagttgtcattaccaaatat
attgaaaatgctaaagaaattgaaatggatgctgttgccaaagatggtaagatgatcatg
catgttgtttctgaacacgttgaaaatgctggtgtccattctggtgacgctactttgatt
gttccaccacaagatttggatccagaaaccgttagaagaatcgtcgaagctactgccaag
attggtaaagctttggatatcactggtccttacaatattcaattcattgccaaagacaat
gatatcaaagtcattgaatgtaacgtcagagcatcaagatcattcccatttgtttctaaa
gttgttggtgttgatttgattgaaatggctactaaagctatgttggacttgccaattgtt
ccatatccaggtgaaagattacctgaggattactgtgctgtcaaagtgccacaattttca
ttctcaagattagctggtgctgatcctgttttaggagttgaaatggcttccactggtgaa
gttgctacttttggtaagaacaaatacgaagcttatttgaaatcattaatttccactgga
ttcaaattaccaaagaaaaacattttgttttctattgggtcattcaaagaaaagcaagaa
ttattaccaagtattgccaaattacatgaattgggttacaaaatctttgccactgctggt
actgccgatttcattaaggaacatggtattccagttcattatttggaagtcttgagtaaa
gatgaagatcaaaaatccgaatataatttgagccaacatttagctaacaacttgattgac
ttgtatgtcaacttgccatctgccaatagattccgtcgtccagcttcttatatgtctaaa
ggttatgaatctcgtcgtatggctgttgattatgctgttccattggttaccaatgttaaa
aacgccaaattattagttgaagctattgctagaaacatttctttggaagtttccaacaga
gatgctcaaacttctcatggtactgctattttacctggattgatcaacattacttccttt
gctacttcatttgatgattttgaacaaaccaccaaagaatcattagctgctgggttcact
tttaacgccttcttgcctcatactcaagctggtgcttcagttactgattacagaagtctt
attgacgccattgatgctgttggtgctagtgcatacaccgattattccgtttccattgct
gcttctgaaaccaattctcaaagtgtcagtgatgctgccgacaatgcaggatctttgttc
ttaccattcaatgattttgccaattctaaagtttcagccttgactgctcaattttcatct
tggccaaacaacaagccaatcattactgatgccaaaactactgatttagcttcagtttta
ttgttggcctcattgtacaacaggtccattcacattactggtgtttcttctaaagaagat
ttggatttgattaagatggctaaagaaaaaactttacaagttacttgtgatgttgctgtc
cattcattgttcttatctaaagatgaattggattatccattcttaccaaacaaacaagat
caagaatatttgtgggaaaacttgaaagatgttgattgtttctccattggtgttttgcca
tatttgattgctaaggcatctggtactgagattgctccgggtatgggaatcaaagaagct
gttccattgttattaactgctgttaaagccggtaaacttactatcggtgacattgttagt
aaattccacgataatccagccaaaatcttcaacttgccaaaacaagatgctcaagttgtt
cttgatttggatagatttgctactgttgaaccagtgtatcctgaattttctaaattgaga
ttgagaggtgccgttgaaagagtttccttccataatgaaactgttgtattggatggttct
gttttgtctcaaattgccttgggtaagaatgaagttgtaccaagaagtagatttggatcc
actgcaggtattccagaatcaccaagactcggtaacaagagagtctcattcagtagtgat
atgcgtcgtccatcattggcaccagaaactccagaaccacaaccagcaattttcgaaaaa
ttgggttctgaattagtttctcaaccaattgctggatcattaggtgaaattgctgccttg
agtgattacatcagacacaacaatactttcttaagaaacaacattatttctgttaaagac
attaccagatcagatttgcattcattattcactgttgctcaagaaatgagattggcagtt
gaaagacaaggggttttggatctcttacaaggtagagtgttggccaccatgttttatgaa
ccatctacaagaacttccacttcatttgatgctgctatgcaaagattgggtggtagagtt
gttgctgttgatcatggttcatcttcagttaaaaagggagaaactttacaagataccatt
agaactttgtcatgttattccgacgctattgtattaagacatccatcagaagagtcagct
gacattgctgctaaatattcaccagttccaattattaatgctggtaatggtaccaaagaa
catccaactcaagctttattagatttgttcactattagagaagaattgggtactgttaat
ggtattacggttacttttatgggtgatttgaaatacggtagaccagtacattcattatgt
cacttgttacgtcattatcaagtcagagttcaattagtggcaccaaaagaattacaaatt
ccagctgaaatcagacaacaattaattgataacaatatgttgattgctgaatccgaagaa
ttaactaaagaaattcttgctagatctgatgttttatactgtactagagttcaagaagaa
agatttgctgataaagaacaatatcaaagattgaaagatacttatatcgttgacaataag
attttgagtaatgctaaacaacacatgtgtgttatgcatccattaccaagaactaatgaa
attagagaagaagttgatttcgatcaaagagctgcatattttagacaaatgagacacggt
ttatttattagaatggccttattggcaatggttattggtgttgatttttaa

DBGET integrated database retrieval system