KEGG   Candida albicans: CaO19_1331Help
Entry
CaO19_1331        CDS       T00189                                 

Gene name
CaJ7_0396
Definition
hypothetical protein
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 472 aa AA seqDB search
MLDELSYKVLTNLETSYERKQPLGSKLIDRYTLTIDQSTVAQQSYFEQIIPAINRILMNS
EAHVIDPDNVLIRLLPEILSHLSFEQILMYYPNDFILHFLFEEKLENVSVICLEVILLNL
QEPETLQFLRDNNVISRLLREVYFKKTPISVLNKIERLITVLNGIEEINLLESCLPILKK
IRDQGNTVLLSRYLDLVNLLLRYLPEFSPHLYSFTKQEFLKYQDDPLFLILLIQFYVKLV
RLKAPVDLSLPLSDILSLYDKFDLLVKNEVVELVAQLSFTQSYTDILFKSQIFKTHNLLE
VFEKTENSDIRLLSKANPQVIYELNNSIYPDVLAHLNLFTNNLYFPILLNFMSSTTIFYQ
LKLHLNNEKLSQLPMDKLFKLLLEMSTHNHSKEHLFNNLPTIMSTNLLETEDLRNNELWN
LKLEILQNLLNDDSVPGFEFWHQELTRNYELMTFGRVFRNAAPRVDIIDETA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgaattatcatacaaggttttaactaatctagagacgagttatgaaagaaaa
caaccgttggggtcaaaattgatcgataggtatactttaaccattgaccaatcaactgtt
gcccaacaatcatattttgaacaaatcattcccgcaatcaatcgaatattgatgaattca
gaagctcatgtaattgatcctgataatgtgttaattcgattattaccggaaattttaagc
catttaagttttgaacaaattttgatgtattatcccaatgatttcattttacacttttta
tttgaggaaaaattagagaatgtcagtgtaatatgtcttgaagttattttattgaatctc
caagaaccggaaacattgcagtttttacgtgacaataacgtgattagtagattgttacgc
gaggtatactttaaaaagaccccaatttcagtattaaacaagattgaacgtttaattacc
gtgttaaatggtattgaagaaatcaatttacttgaactgtgtctccccattttgaagaaa
attcgagaccagggaaatactgtattattgtcacgttatttggatttggtgaatttgtta
ttacggtatttaccagaattttcacctcatttgtacagttttaccaaacaagaatttttg
aaataccaggatgatcctttattcttgattttattgattcaattttatgtgaaattggtt
agattgaaagctccagttgatttgagtctcccattgagtgatatattatcattatatgat
aagtttgacttgttggttaagaatgaagtagttgaacttgtggcacaattatcattcact
caatcatatactgatatacttttcaagagtcaaatttttaaaactcataatttacttgaa
gtatttgagaaaactgaaaattccgatattcgattacttagcaaagctaatcctcaagtt
atttatgaattgaataattcaatttatcctgatgtattggctcatttaaatttatttact
aataatttatatttccccattttgttaaatttcatgagttcaacgacaatattttatcaa
ttgaaattacatttaaataatgaaaaattatcacaattaccaatggataaattgtttaaa
ttattattggaaatgtcgactcataatcatagtaaagaacatttatttaataatttgcct
actattatgtctacgaatttattagaaactgaagatcttagaaataacgaattatggaat
ttaaaattggaaattttacaaaacttgttaaatgatgattcggtaccaggatttgaattt
tggcatcaagaattgacgagaaattacgaattgatgacatttggtagagtttttcgtaat
gctgctccaagagttgatattattgatgaaactgcctag

DBGET integrated database retrieval system