KEGG   Candida albicans: CaO19_5130Help
Entry
CaO19_5130        CDS       T00189                                 

Gene name
CaJ7_0374
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cal  Candida albicans
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cal04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 560 aa AA seqDB search
MKFWTYSTKVLATLLAVVSITHASGPTDGDAVADPNSAVVKLTSENFASFIEENPLILAE
FFAPWCGYCKMLGPEYSKAADSLNESHPKIKLAQIDCTEDEALCMEHGIRGYPTLKIIRD
GDSKTAEDYQGPREAAGIADYMIKQSLPAVQFPETFEELDTLIDAQTKPFVLQINPTEDG
NATFNKVANQKRKDYVFINVEDKQIIKDLNKKFKNVDITGKKPSYLVVQPKQFDEVAKFD
GKKIDAESLTEFIGVEAVPYFGEINQDTYMTYMTSPLPIAYYFYNNAEQREAIADDLTKL
GKKYRGKLNIVGLDASLFGRHAEVINMDPEVVPLFAIHHISDNKKFGVNQTDYPEGPSFK
VIEKFVADYFADKLTPIIKSEPLPTEEEKSANPVVKLVAHNYKDVLEQTDKDVFVKYYAP
WCGHCKKLAPTWEELAEIFGSNKDDAKVVVADIDHTNNDVDVPYNIEGYPTLLMFPANGK
VDEKTGIREPIVFEGPRELDTLIEFIKEKGALNVDGAELKAKLDEQKATKEDEEVEEEKE
EEEEEEAPVEDKENVEHDEL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttggacttactcaactaaagtgttagctactttattagctgttgtctctatt
actcacgccagtggtccaaccgatggtgacgccgttgccgatccaaacagtgctgtcgtt
aaattgacttcagaaaactttgcctccttcattgaagaaaatccattgattttggccgaa
ttctttgccccatggtgtggttactgtaaaatgttgggaccagaatattctaaagctgct
gattccttgaatgaatcccatccaaagattaaattggcccaaattgactgtactgaagat
gaagccttgtgtatggaacatggaatcagaggttacccaactttaaaaatcattagagat
ggtgatagcaaaactgctgaagactatcaaggtccaagagaagctgctggtattgccgat
tacatgattaaacagtctttaccagctgttcaattccctgaaacttttgaagaattggat
actttaatcgatgctcaaactaaaccatttgttttacaaatcaatcctactgaagatggt
aacgcaactttcaataaagttgctaatcaaaagagaaaagattacgtctttattaatgtt
gaagataaacaaattatcaaagatttaaataaaaaattcaagaatgttgacatcaccggt
aagaaaccaagctatttggtggtccaaccaaaacaatttgatgaagttgccaaatttgat
ggtaagaaaatcgatgctgaatccttgactgaattcattggtgttgaagcagttccatac
tttggtgaaatcaaccaagacacttatatgacttatatgacttctccattgccaattgct
tactatttctataataatgctgaacaaagagaagccattgctgacgatcttaccaagttg
ggtaagaaatacagaggtaagctcaatattgttggtttagatgctagcttgtttggtaga
cacgctgaggttatcaatatggacccagaagttgtcccattgtttgccattcatcatatt
tctgataacaagaaattcggagttaaccaaactgattaccctgaaggtccatcattcaaa
gtcattgaaaagtttgttgctgattactttgctgataaattgaccccaattattaaatca
gagccattaccaacagaagaagagaagtcagctaatccagtagttaaattagtggcccac
aattacaaagatgttttggaacaaaccgataaagatgttttcgtcaaatactatgctcct
tggtgtggtcattgtaagaaattggctccaacttgggaagaattggctgaaatctttggt
tctaataaagatgatgctaaagttgttgttgctgatattgaccatactaataatgatgtt
gatgttccatataacattgaaggttacccaactttattgatgttcccagctaatggtaaa
gtcgatgaaaaaaccggaattagagaaccaattgttttcgaaggtccaagagaattagat
actttgatcgaatttattaaagaaaaaggggcattgaatgttgatggtgctgaattgaaa
gctaaattggatgaacaaaaagctactaaagaagatgaagaagtggaagaagaaaaggaa
gaagaagaagaagaagaagctccagttgaagacaaagaaaatgttgaacacgatgaattg
tag

DBGET integrated database retrieval system