KEGG   Candida albicans: CaO19_5130Help
Entry
CaO19_5130        CDS       T00189                                 

Gene name
CaJ7_0374
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cal  Candida albicans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CaO19_5130 (CaJ7_0374)
Enzymes [BR:cal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CaO19_5130 (CaJ7_0374)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CaO19_5130 (CaJ7_0374)
  Exosomal proteins of colorectal cancer cells
   CaO19_5130 (CaJ7_0374)
  Exosomal proteins of bladder cancer cells
   CaO19_5130 (CaJ7_0374)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 560 aa AA seqDB search
MKFWTYSTKVLATLLAVVSITHASGPTDGDAVADPNSAVVKLTSENFASFIEENPLILAE
FFAPWCGYCKMLGPEYSKAADSLNESHPKIKLAQIDCTEDEALCMEHGIRGYPTLKIIRD
GDSKTAEDYQGPREAAGIADYMIKQSLPAVQFPETFEELDTLIDAQTKPFVLQINPTEDG
NATFNKVANQKRKDYVFINVEDKQIIKDLNKKFKNVDITGKKPSYLVVQPKQFDEVAKFD
GKKIDAESLTEFIGVEAVPYFGEINQDTYMTYMTSPLPIAYYFYNNAEQREAIADDLTKL
GKKYRGKLNIVGLDASLFGRHAEVINMDPEVVPLFAIHHISDNKKFGVNQTDYPEGPSFK
VIEKFVADYFADKLTPIIKSEPLPTEEEKSANPVVKLVAHNYKDVLEQTDKDVFVKYYAP
WCGHCKKLAPTWEELAEIFGSNKDDAKVVVADIDHTNNDVDVPYNIEGYPTLLMFPANGK
VDEKTGIREPIVFEGPRELDTLIEFIKEKGALNVDGAELKAKLDEQKATKEDEEVEEEKE
EEEEEEAPVEDKENVEHDEL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttggacttactcaactaaagtgttagctactttattagctgttgtctctatt
actcacgccagtggtccaaccgatggtgacgccgttgccgatccaaacagtgctgtcgtt
aaattgacttcagaaaactttgcctccttcattgaagaaaatccattgattttggccgaa
ttctttgccccatggtgtggttactgtaaaatgttgggaccagaatattctaaagctgct
gattccttgaatgaatcccatccaaagattaaattggcccaaattgactgtactgaagat
gaagccttgtgtatggaacatggaatcagaggttacccaactttaaaaatcattagagat
ggtgatagcaaaactgctgaagactatcaaggtccaagagaagctgctggtattgccgat
tacatgattaaacagtctttaccagctgttcaattccctgaaacttttgaagaattggat
actttaatcgatgctcaaactaaaccatttgttttacaaatcaatcctactgaagatggt
aacgcaactttcaataaagttgctaatcaaaagagaaaagattacgtctttattaatgtt
gaagataaacaaattatcaaagatttaaataaaaaattcaagaatgttgacatcaccggt
aagaaaccaagctatttggtggtccaaccaaaacaatttgatgaagttgccaaatttgat
ggtaagaaaatcgatgctgaatccttgactgaattcattggtgttgaagcagttccatac
tttggtgaaatcaaccaagacacttatatgacttatatgacttctccattgccaattgct
tactatttctataataatgctgaacaaagagaagccattgctgacgatcttaccaagttg
ggtaagaaatacagaggtaagctcaatattgttggtttagatgctagcttgtttggtaga
cacgctgaggttatcaatatggacccagaagttgtcccattgtttgccattcatcatatt
tctgataacaagaaattcggagttaaccaaactgattaccctgaaggtccatcattcaaa
gtcattgaaaagtttgttgctgattactttgctgataaattgaccccaattattaaatca
gagccattaccaacagaagaagagaagtcagctaatccagtagttaaattagtggcccac
aattacaaagatgttttggaacaaaccgataaagatgttttcgtcaaatactatgctcct
tggtgtggtcattgtaagaaattggctccaacttgggaagaattggctgaaatctttggt
tctaataaagatgatgctaaagttgttgttgctgatattgaccatactaataatgatgtt
gatgttccatataacattgaaggttacccaactttattgatgttcccagctaatggtaaa
gtcgatgaaaaaaccggaattagagaaccaattgttttcgaaggtccaagagaattagat
actttgatcgaatttattaaagaaaaaggggcattgaatgttgatggtgctgaattgaaa
gctaaattggatgaacaaaaagctactaaagaagatgaagaagtggaagaagaaaaggaa
gaagaagaagaagaagaagctccagttgaagacaaagaaaatgttgaacacgatgaattg
tag

DBGET integrated database retrieval system