KEGG   Candida albicans: CaO19_5506Help
Entry
CaO19_5506        CDS       T00189                                 

Gene name
CaJ7_0425
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cal  Candida albicans
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CaO19_5506 (CaJ7_0425)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CaO19_5506 (CaJ7_0425)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CaO19_5506 (CaJ7_0425)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1100 aa AA seqDB search
MLESLNRRNSIDSNQGDNDNDNDNHSNDELSPSELYYSPSGSPPKSQLLLRKSSSPSSYS
PIKSDLPNIYSHLRSNDSESPPQPSPKQQSSLSSSSSSSSSSNTKSSTTKNIFKKLLRIN
KSSDNIDESRSIVSNNGGSPMSDSTTVTSTLSTDTAPKRGKSIQRSQILHHTDSDSLYLE
NQIELRPEISKSIGNIKIPSIFTNDGMPLLKISHKSKKRILFWIDPSCFKFSWRMANSTT
TTTSATTSATTSGLPQGITNTTALSNSAIISTPAIATSAIHRLSITNRTTHEFALDDIKS
IYIQNEGSGYREELNISQKLEKNWITIIYFNHKKNSLKSLHLITDNDHDFKKLISAIYNL
KQLRSQLAKEFLIDLNELDENYVKMLLNKELLAGDNGNVDGNEVDIQKSHKHVREFLSFN
DILKYSKRLNINVNTNHLQQIFDQVLLLSSATTEKPVSTPLFEKGLNFEQFKQFVSILKD
RKDLQEIWDSLAQGKEVLQFDEIKNFIINIQKENFSDDDDNSTINLIFQKYCSNDNGWNK
ESLNEYLLSSYSTPYREITQTQTNYYDYPLNEYFISSSHNTYLTGRQVAGDSSVEGYIRT
LQRGCRCVEIDIWNGDSNTTTTTVIGTKDDDDKNEYEPIVNHGRTFTKPISFANVIRAIK
KFAFIVSPWPLILSLEIHCSPECQIKVVNILKDILGENMIIAPIDIDSVILPSPAELKHK
FIIKVKKTTSFQNLIETENGSFTTSTTTTTTTTTTTTTTATSLSEDNENNKSNSSSTSSF
IIRRRKNKSPKIINELSNLGIYTQGIKFRNFSLPESKTFNHCFSLGEKSINRMIKDDDKK
ISLDKHNRRYLMRVYPSGTRLKSSNFNPLPYWSHGVQMVATNWQTYDLGQQLNEALFENK
IFQGYVLKPSVLRKPTLKSSSSNVDTRTSLTTTNSKTIRFNFEIISGHQLPKFPKDDYKD
QAINPYISFEIIGAQDVQWDNNDSSPIAPTTSSSPFIRTTKIIRENGFNPNFNTKFSGSI
ITTTNDLIFIKFVVYASTSLNYPDYGENFPIAILVTKLNYLKQGYRYIYLNDLLGEQLVY
SSIFIKIEYDEDLLNEFINK
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgttggaatcattaaatcgtcgaaattcaattgatagtaatcaaggtgataacgacaat
gacaatgacaaccatagtaatgatgaattaagtccatcagaattatattattcaccatct
ggtctgcctcctaaatcacaattattacttcggaaatcatcttcaccatcatcttattct
ccaattaaatctgatctacctaatatttatagtcatctacgatctaatgatagtgaatcg
ccgccacaaccatcgccgaaacaacaatcttctttatcatcatcatcatcatcatcgtca
tcttcaaatactaaatcttccacaactaagaatatttttaaaaaattattacgaattaat
aaatcatcagataatattgatgaatcaagatcaattgtactgaataatggtggttctcca
atgagtgatagtactactgtgacatcaactttgtcaactgataccgctcctaaacgaggg
aaatcaattcaacgaagtcaaattttacaccatactgattcagattctttatatttagaa
aatcaaattgaattacgtccagaaatttctaaatctattggtaatattaaaatcccgagt
attttcactaatgatggtatgccattattaaaaatatctcataaatcaaagaaaagaatt
ttattttggattgacccttcatgtttcaaattttcttggagaatggctaattcaacaacc
accaccacgtcagccaccacatcggccacaacttctggattaccccaaggaattactaat
actaccgcattatctaattcagcaatcatatccacaccagcaatagcaacatcagctatt
catcgattatcaataaccaacagaacgactcatgaatttgctcttgatgatattaaatca
atatatatacaaaatgaaggtagtggatatcgtgaagaattaaatatatctcaaaaactt
gaaaaaaattggatcaccattatatattttaatcataaaaaaaatagtttaaaatcatta
catttaatcactgataatgatcatgattttaaaaaattgattctggcaatttataattta
aaacaattacgttcacaattggcaaaagaatttttaattgatttgaatgaattagatgaa
aattatgttaaaatgttattaaataaagaattactagctggtgataatggtaatgttgat
ggcaatgaagtcgatattcagaaatctcataaacatgttagagagtttcttagttttaat
gatattttaaaatattccaaacgattaaatattaatgttaataccaatcatttacaacaa
attttcgatcaagtactactactactgtcagcaacaacagaaaagcctgttagcaccccc
ttgtttgaaaaggggttaaattttgaacaatttaaacaatttgtttcaatacttaaagat
cggaaagatttacaagaaatttgggattcattagctcaaggtaaagaagttttacaattt
gatgaaattaaaaatttcattattaatattcaaaaagaaaatttcagtgatgatgatgat
aatagtactattaatttaatttttcaaaaatattgtagtaatgataatggatggaataaa
gaaagtttaaatgaatatttattatctagttattcaactccatatcgtgaaatcacccaa
acccaaactaactattatgattatccattaaatgaatattttatttcatcatctcataat
acttatttaactggtcgacaagttgctggtgattcatcagtagaagggtatatacgaaca
ttacaacgtgggtgtcgatgtgttgaaattgatatttggaatggtgatagtaacaccacc
accaccaccgtcattggtacaaaagatgatgatgataagaatgaatatgaaccaatagtt
aatcatggaagaacgtttactaaaccaataagctttgctaatgttataagagcaattaaa
aaatttgctttcattgtatcaccttggccattaatacttagtttggaaattcattgttca
ccggaatgtcaaattaaagtagttaatattttaaaagatattcttggagaaaatatgatt
attgctcctattgatattgattcggtgatattaccatcaccagccgaattgaaacataaa
tttataattaaagtgaaaaagacaacttcatttcaaaatttaatagaaactgaaaatggt
agtttcacaacaagtactactaccaccaccaccaccactactactactactactactgca
acttcattaagtgaagataatgaaaataataaatctaatagtagttctacatcatcattc
attataagacgaaggaaaaataaatcaccaaaaatcatcaatgaattaagtaatcttgga
atctatactcaagggataaaatttcgtaatttttcattaccagaatctaaaacctttaat
cattgtttttcattaggtgaaaaatcaattaatcgaatgattaaagatgatgataaaaaa
atttctttagataaacataatcgtcgttatttaatgagagtttatccactgggaacaaga
ttaaaatcttcaaattttaatccattaccttattggtctcatggtgtacaaatggtagcc
accaattggcaaacttatgatttaggtcaacaattgaatgaagcattatttgaaaataaa
atatttcaaggatatgtattaaaaccaagtgtattaaggaaaccaactttaaaatcaagc
agtagcaatgtcgatacaagaacgtcattaactactactaattctaaaactattcgattt
aattttgaaattataagtggtcatcaattacccaaatttcctaaagatgattataaagat
caagccattaatccatatatatcatttgaaataattggtgctcaagatgttcaatgggat
aataatgacagctcaccaattgcaccaaccaccagttcttctccctttattagaacaacg
aaaataattcgtgaaaatggatttaatccaaattttaatactaaatttagtggttcaatc
atcactactactaatgatttaatatttataaaatttgttgtttatgcatcaacttcttta
aattatcctgattatggggaaaatttccctattgctatattagtcactaaattaaattat
ttaaaacaaggttatagatatatttatctaaatgatttattaggtgaacaattggtttat
tcttcaatatttataaaaattgaatatgatgaagatttattaaatgagttcataaataaa
taa

DBGET integrated database retrieval system