KEGG   Candida albicans: CaO19_6584Help
Entry
CaO19_6584        CDS       T00189                                 

Gene name
CaJ7_0160
Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cal  Candida albicans
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cal03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 739 aa AA seqDB search
MSINEEDYLQLEKEIKLDDIDFSDLEEKYEVNIGLDNYIIVDGAPIAPEAKVPVLIKVLR
KLFSQVGEIVEGDEGIYMPLENGKSKGYLFIQFKSTESADLAIKKLHGKKLDQNHRLLVN
KLSDMEKYGVDGAVNEEFIEPEIEPFQSHGYLKSWLQDEQGRDQMVLHFSETVGVYWNKK
SADPEPVIEPRKGFTSKYAKFSPKGTYLFSIHPQGIQSWGGANFNSIKRFFHQQVRLVDF
SPNEKFMVTLSPIPISLPDSTVDRAQFPFGPESEGHKLVIWNMITGEPVRTFALPPHLEG
QKEMPWPLVKWSYDDKYCARQGPDALAIYETESNFQLLDKKLVKVDGIQDFEWAPAGVKL
HNSKAVDGKHVLSYWTPESTNQTARVALMQIPSREILRTVNLFQVSDCKMHWQSNGKLLC
VKVDRHTKSGKTIFSNLEFFKTNERDIPVEKLELKDVVVNFAWEPNTERFITISRLDDGN
PNPAIPKNTISFYAPEVTKGGVNHNSKKKGGAAIAAAVAAAAINNQSSTKYKAYTKIENK
HSNTIFWSPKGRYVVVATISRTSGELEFFDVSFDDETNKKSLPANVKLLKTDKFSGMTNI
SWDPSGRFVAAWSTSWLHAIENGYRLYEFTGNLLRDDSIDQFKDFVWRPRPPSLLTNSDK
KKVRSNLREYSAQFEEADAMEADAAVKEIILARRKALEEWRKYRAKHISKQGNSKNEVQA
EIIEEIKEEIIEEKEEIVE
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaacgaggaagattatcttcaacttgaaaaggaaatcaaattagatgacatt
gatttttctgatttagaagaaaaatatgaagttaatattggattagataattatattatt
gttgatggagctccaattgcaccagaagctaaagttccagttttaattaaagttttacgg
aaattattttctcaagttggggaaattgttgaaggagatgaaggaatttatatgccatta
gaaaatggtaaatctaaaggatatcttttcattcaatttaaatcaacagaactggccgat
ttagccattaaaaaattacatgggaaaaaattggatcaaaatcatcgattattagttaat
aaattatctgatatggaaaaatatggtgttgatggagctgttaatgaagaattcattgaa
ccagaaattgaaccatttcaaagtcatggatatttgaaatcttggttacaagatgaacaa
ggtagagatcaaatggttttacattttagtgaaacggtaggagtttattggaataaaaaa
tctgctgatccagaaccagtcattgaaccaagaaaagggtttacttctaaatatgctaaa
ttttcaccaaaagggacatatttattttcaattcatcctcaaggtattcaatcatggggt
ggagctaatttcaatagtattaaaagatttttccatcaacaagttagattagttgatttt
tctccaaatgaaaagtttatggttactttatcacctattccaattagtttacccgattca
acggttgatcgtgctcaattcccatttggtcctgaaagtgaaggtcataaattggtcatt
tggaatatgattactggtgaaccagtcagaacatttgctttaccacctcatttagaagga
caaaaggaaatgccgtggccattagttaaatggtcttatgatgataaatattgtgctcgt
caaggaccagatgctttagccatttatgaaactgaatccaatttccaattattagataaa
aaattggttaaagttgatggtattcaagatttcgaatgggctccagctggggttaaactt
cataatagtaaagctgttgatggtaaacatgttttgagttattggactccagaaagtact
aatcaaaccgctagagttgccttgatgcaaattccttcgagagaaattttacgtactgtc
aatttattccaagttagtgattgtaaaatgcattggcaatctaatgggaaattattatgt
gttaaagttgatcgtcatacaaaatcaggtaaaactattttctccaatttggaatttttc
aaaactaatgaaagagatatcccagttgaaaaattagaattaaaagatgtggtggttaat
tttgcttgggaaccaaatactgaaagatttattactattagtagattagatgatggtaat
ccgaatcctgctattccaaaaaataccatttcattctatgcaccagaagttaccaaaggt
ggagttaatcacaatctgaaaaagaaaggtggtgccgccattgctgctgctgttgctgct
gctgctattaataatcaactgtcaactaaatataaggcatacaccaaaatcgaaaacaaa
cactcaaacactattttctggtcaccaaagggaagatatgttgttgttgctactatttca
agaacttctggtgaattggaatttttcgatgtttcatttgatgatgaaactaataaaaaa
tcattacctgctaatgtcaaattattaaagaccgataaattttctggaatgaccaatatt
tcttgggatccatcaggtagatttgttgctgcttggtcaacttcttggttacatgccatt
gaaaatggttatagactttatgaattcactggtaatttattaagagatgattcaattgat
caattcaaagattttgtttggagaccaagaccaccatctttattgaccaatagtgataaa
aagaaggtcagatccaatttacgtgaatatagtgcacaatttgaagaagctgatgctatg
gaagctgatgctgctgttaaagaaatcattttggctcgtagaaaggctttggaagaatgg
agaaagtaccgtgccaaacatattagtaaacaaggtaattccaagaacgaagttcaagca
gaaattattgaagaaattaaagaagagattattgaagaaaaagaagaaattgttgaataa

DBGET integrated database retrieval system