KEGG   Candida albicans: CaO19_6684Help
Entry
CaO19_6684        CDS       T00189                                 

Gene name
CaJ7_0402
Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
cal  Candida albicans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CaO19_6684 (CaJ7_0402)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CaO19_6684 (CaJ7_0402)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 244 aa AA seqDB search
MKKTALIVVDLQEDFLPPNGSLAIKNGRSVIPKINQLLPSQDNHSKFDWSLIVATQDWHP
PNHTSFASQHENVAPFTEIEFIHPEKKLDPKTNQPIVMNQIVWPDHCVQGTKGAQLEPSF
ANQFEKLTKQDDNNTAPCKIVKKGYLPDREYYSCFQDCWGLHHTELIDLLHEYDIENVVF
VGLAYDFCVLSSAIDSAKNGFKTFVLKNYCESVYPEKINDTDKLFIDNGVTIVDNDEKFD
SLFK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacagcattaatagtagttgatctacaagaggatttcttaccgcctaatgga
tcattggccattaaaaatggtcgatcagttatacccaaaatcaaccaattattaccatca
caagataatcattccaaatttgattggtccttaattgttgcaacacaagattggcatcca
ccaaatcatacttcatttgcctctcaacatgaaaatgttgcaccatttactgaaattgaa
ttcattcacccagaaaagaaacttgacccgaaaacgaatcaaccaattgttatgaatcaa
attgtttggccagatcattgtgtacaaggcaccaagggagctcagttggaacccctgttt
gctaatcaatttgaaaaattaacaaaacaagatgataataatactgccccatgcaaaata
gtgaaaaaggggtatctacctgatcgtgaatattattcatgtttccaagattgttggggg
ttacatcatactgaattgattgatcttttacatgaatatgacattgaaaatgttgttttt
gtagggttagcttatgatttctgtgttttaagttcagctattgatagtgctaaaaatgga
tttaaaacatttgttttgaaaaattattgtgaatcggtttatccagagaaaattaatgac
acagataaactatttattgataatggtgttacaatagttgataatgatgagaaatttgat
tctttatttaaataa

DBGET integrated database retrieval system