KEGG   Candida albicans: CaO19_7140Help
Entry
CaO19_7140        CDS       T00189                                 

Gene name
CaJ7_0501
Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cal  Candida albicans
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CaO19_7140 (CaJ7_0501)
Enzymes [BR:cal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     CaO19_7140 (CaJ7_0501)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CaO19_7140 (CaJ7_0501)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 248 aa AA seqDB search
MSKETEFYNYITTLPETTLSQVRGKPHEVLKLIDEYPQNFMNIGPHKGTQIVTRIKEKAP
KTMIELGGYLGYSAVLFANEIADDPDAKYYSFELNPEFAKIATYVIDLAGLSDKVEIIVG
RASYTLPAFRQRLFSENKHYTGLDFIFIDHWKDLYVPDLRVLESLNLIAPGTLIVADNII
TPGAPEYVVYVNFSPDEKKLYNETTKNPEGKEFIGRWNILYDTKTIEVATANHKDAIEVT
KCVDYFSG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaacagagttctacaactatatcaccaccctcccagagaccaccctctct
caggtcaggggcaaaccccatgaagttttaaagttaattgatgagtacccccaaaacttc
atgaacattggcccacacaagggtacacaaattgtcaccagaatcaaagagaaagcccct
aaaaccatgattgagttgggtgggtatttagggtactcggcagtcttatttgccaacgaa
attgctgacgacccagacgcaaagtactacagtttcgagcttaacccagagtttgccaaa
attgccacctacgttatcgacttggcagggttgctggataaagttgagataatcgtgggc
agggcctcatacactttgccagctttcagacagagattgttttcggaaaataaacactac
actggattggactttatttttattgaccattggaaggatttgtatgtcccggacttaaga
gttttagagtcactcaaccttattgccccaggaacattgattgttgctgataatattatt
acgcccggcgctcccgagtacgtggtctacgtaaacttttcacccgatgagaaaaagctc
tacaatgaaaccaccaagaaccccgaaggaaaggagtttattggtaggtggaacattcta
tacgatacaaaaaccattgaagtcgcaaccgccaaccacaaagacgcaatcgaggtaact
aaatgtgttgattatttctctggataa

DBGET integrated database retrieval system