KEGG   Calothrix sp. PCC 7507: Cal7507_0228Help
Entry
Cal7507_0228      CDS       T02358                                 

Definition
glutathione S-transferase-like protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cal7507_0228
Enzymes [BR:calo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cal7507_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(210295..211512)
Genome map
AA seq 405 aa AA seqDB search
MSIQETLSSWDQLLEIARQNTPARRVRRPGQAPSTAPIPSSLDKLAPGTEPPVLLYRDTN
SWCPFCERVWFALEEKQIPFATEFIDLTNKPKWYTDLVPTTLVPAAKIEGELVYESKDIL
LALEAKYSPSLLPEDPAENAVARQWLDEAETNGIRNTAYQFLRQPPENPDELASLQAAFE
AKLDELEQLLGKYPGPYFLSTFSVVDITYSPHLDRLAANLPVYRGYHLKGNPRYPRINAW
FEALKQRPAYQRVKSDDATNNLLLRRRWGVEPIGNPLPPDPAASQEIQFRAEAAERLSDN
REVAIGDILKNSGVQALAKDGDTTAVKEAVDFHLRLLADYLINGNGAPLPWGRIGGKDNA
DPSTAAVGAITLAYVRNRICAPRDMSAGAATAFRAAADKVLASLY
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattcaagaaacactatcaagctgggatcaactgttagaaattgctcgacaaaat
acccccgctcgacgggtgcgtagaccaggacaagcaccttccacagcacccattcccagc
agtcttgataaactggctccaggtactgaaccaccagtactgctttaccgtgatactaac
tcttggtgtcctttttgtgagcgggtttggtttgcattggaagaaaaacaaattcccttt
gcaacggagtttatcgatttaactaacaagccaaaatggtacaccgatttagttcctaca
acccttgtacctgcagccaagattgagggagagttagtttatgaatccaaagatattctg
ttagcattagaagcaaaatatagccctagcttgcttccagaagacccagcagaaaacgcg
gttgctagacaatggttagacgaagccgaaaccaatggtattaggaatactgcctatcaa
ttcctcagacaaccaccagaaaatcctgatgaattagccagtttacaggcagcttttgaa
gcgaaattagatgaactggagcaactattaggaaagtatccaggcccctactttttgtca
acatttagtgtggtagacattacctatagtccccacctagatagattggcggctaaccta
cccgtgtacaggggatatcacctcaaaggtaatccccgctatcctcggattaacgcttgg
tttgaagcactcaaacagcgtcccgcctatcagcgagtcaaatcggatgacgctaccaat
aatttacttttgcgtcgtagatggggagtagaaccaattggcaatcccttaccaccagat
cctgcagccagccaagaaatccaatttcgggcggaagctgcggagagattgagcgataac
cgagaagtggcgatcggggacatcctgaaaaactccggggtgcaagctttggcgaaagat
ggagatacaacagccgttaaagaagcggttgattttcacctgcgactactagccgactat
ctaattaatggcaatggcgcacctttaccatggggacgtataggcggtaaggacaatgcc
gatcctagcactgctgcggtgggagccatcaccctggcttatgtgcgaaatcgcatctgt
gccccccgtgatatgagcgccggtgcggcgacagcattccgtgcggctgccgataaagtc
ttggcatcgctttattag

DBGET integrated database retrieval system