KEGG   Calothrix sp. PCC 7507: Cal7507_0429Help
Entry
Cal7507_0429      CDS       T02358                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
calo  Calothrix sp. PCC 7507
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:calo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cal7507_0429
DNA repair and recombination proteins [BR:calo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cal7507_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(454933..455619)
Genome map
AA seq 228 aa AA seqDB search
MSVGDVTSTTTPKFPKNVIIVKVKHIGDKTTVYARPLARLIEQLQRLPGVGPKSAQRLAL
HILKRPESEVEALAQALIDAKKQIGLCSVCFHLSAEPVCEICRNPNRDQNTICIVADSRD
VIALEKTREYKGKYHVLGGVISPMDGIGPEQLTIQALVRRVSQQKPQEVILAISPSVEGE
TTTLYVGHLLKPFTKVTRIAFGLPVGGDLEYADEVTLARALEGRRELD
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtaggagatgtcacctcaaccaccacaccaaaattcccgaagaatgtcatcata
gttaaggtaaaacacattggagataaaaccacggtttacgcacgccctttagcacggtta
attgagcagttgcaacgcttaccgggagttggacctaaatcagcccagcgtctagctttg
catatcttgaagcggcctgaatcagaagtagaggctttagcacaagccctgattgatgcc
aaaaaacagataggcttgtgttctgtctgcttccacttgtctgctgaaccggtttgtgaa
atctgccgcaaccctaaccgcgatcagaacactatatgtatagtggcggattctcgcgat
gtgattgcattggaaaaaacccgcgaatataaaggtaagtatcacgttttgggtggggtg
atttcgcctatggatggtattggcccagaacagttgacaattcaagctttggtgcggcgg
gtaagtcagcaaaaaccgcaagaagtgattttggcaattagtccaagtgtagaaggtgaa
accactacactgtatgttggtcatctgttgaaaccatttaccaaggtgacgcggattgct
tttggtttacctgtgggtggagatttggaatatgcggacgaggtgacactggcgagggca
ttggaaggtcggcgggagttggattag

DBGET integrated database retrieval system