KEGG   Calothrix sp. PCC 7507: Cal7507_0700Help
Entry
Cal7507_0700      CDS       T02358                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00330  Arginine and proline metabolism
calo00332  Carbapenem biosynthesis
calo01100  Metabolic pathways
calo01130  Biosynthesis of antibiotics
calo01230  Biosynthesis of amino acids
Module
calo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cal7507_0700
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cal7507_0700
Enzymes [BR:calo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cal7507_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SelB-wing_1
Motif
Other DBs
NCBI-ProteinID: AFY31189
UniProt: K9PEJ2
Position
complement(749619..750728)
Genome map
AA seq 369 aa AA seqDB search
MTKTIVVKIGTSSLTQPATGKLALSTIATLAETLSDLRQQRHRVILVSSGAVGVGCARLG
LTERPKAIALKQAVAAVGQGRLMRVYDDLFTTLQQPIAQVLLTRSDLVQRSRYLNIYNTF
QELLGLGVIPVVNENDTVAVDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSADPRS
VPDAQPIALVSSIKELAELQIQTGTQGSQWGTGGMATKISAARIATAAGVRTVITEGKYP
RNIEKILQGELLGTHFEPQPEPTSARKRWIAYGLVPAGKLYLDVGAIAAISQAGKSLLAA
GIKTVEGEFDPQEAVQLCDINGNEIARGLVNYSSVELQKIRGCHSREIPTLLGYAGVETV
VHRDNLVLT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaaaacaattgtcgtcaaaatcggtacatctagcctgacgcaaccagcaactgga
aaactagcgctttccaccattgcgactttagcggaaacactctctgatttaagacagcag
cgccatcgcgtgattttggtttcctctggtgctgtgggggttggttgtgctaggttgggc
ttaactgaacgtcccaaagcgatcgctctcaaacaagcagttgcagcagtcggacaaggt
agactaatgcgggtgtatgacgatttatttactaccctgcaacaacccattgcccaagtt
ttgctaactcgcagcgacttagtgcaacgtagccgctatctcaacatttacaataccttt
caagaactgctgggactgggagtgattcccgtggtgaatgaaaatgatacggtagcagtt
gatgaactgaaatttggcgacaatgacaccctttcggcattggtcgctagcttagtagaa
gcagattggctattcttgctcaccgatgtagataggctatactccgctgatccgcgttct
gtgccggatgctcaaccgatcgctttagtgagtagcattaaagaattagcagaattacaa
atccaaacaggtactcaaggttcccaatggggtacaggtggtatggcgactaaaatctct
gcagctagaattgccactgctgctggtgtgcgtaccgtgataaccgagggaaaatatccc
cgaaatatagaaaaaatattacaaggtgaattattagggacacactttgaaccgcaacca
gaaccaacatcagccagaaaacgctggatagcttatggtcttgtgcctgcgggaaaatta
tatttagatgtgggtgcgatcgctgcaatttctcaagcaggaaaatcattgttagcggct
ggtatcaaaacagtagaaggagaatttgatcctcaggaagcagtgcaattgtgtgatatc
aacggtaacgaaatcgccagaggattagtcaactacagcagcgttgaattgcaaaaaatt
cgcggttgtcactcgcgggaaattcccacacttttgggatacgcaggtgtagaaaccgtg
gtgcatcgggataatttagttttgacttaa

DBGET integrated database retrieval system