KEGG   Calothrix sp. PCC 7507: Cal7507_0706Help
Entry
Cal7507_0706      CDS       T02358                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cal7507_0706
Enzymes [BR:calo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cal7507_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755415..756065
Genome map
AA seq 216 aa AA seqDB search
MTLSISPDMNSVAQVVSSLSTQQSPTVTEAEMVQAVRTLLLGLGENPDREGLKDTPKRVV
KALKFLTKGYNESLDELLNGAVFTEDANEMVLIRDIDIFSSCEHHILPIIGRAHVAYIPN
GKVIGLSKIARVCEMYARRLQVQERLTLQIADALQGLLKPQGVAVVVEATHMCMVMRGVQ
KPGSWTVTSAMRGIFAEDARTREEFMNLIRHKSNFR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactttatcgattagtcccgatatgaattctgttgctcaagtagtttcatctttatct
actcagcagtcaccaacggtaacggaagcagaaatggtgcaggctgtacgtacgttgctg
cttggattgggagaaaatcctgaccgtgaagggctaaaagatacacctaagcgagttgtc
aaagctttaaagtttctgactaagggatataacgaatccctagatgaactgctaaatgga
gcagtttttacagaagatgccaacgaaatggtattgattcgggacattgatattttcagt
tcctgtgagcatcatatcttaccaattattggtcgtgctcatgttgcatatattcccaat
gggaaggtgattggtttatctaaaattgctagggtttgtgaaatgtatgcacgacgcttg
caagtgcaagaacgtctgactctgcaaattgctgatgcgctgcaagggttactcaaaccc
caaggggtagcagtagtggtggaagcaactcacatgtgtatggtgatgcgaggtgtacaa
aaaccaggttcttggactgtcaccagtgctatgcgcggtatatttgcagaggatgcacga
acccgcgaagagtttatgaatttaatccgacacaaatctaattttcgttag

DBGET integrated database retrieval system