KEGG   Calothrix sp. PCC 7507: Cal7507_0836Help
Entry
Cal7507_0836      CDS       T02358                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:calo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891276..892784)
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPTSFPSRFGIGDLGLEAYRFIDFLKESDQQYWQVLPLGPTGYGNSPYM
SYSAMAGNPMLISPEKLLDEGLLAEEDFANLPAFPAEKVNFDQVVVVKNELLKKASENFK
TKATPIQQKGFEGFCDSKAYWLDNYALFMAIKDSQSGGSWHTWEPELAKRTPEVLEEAQK
HLTTEIFYYKFIQYEFFRQWSELKSYANMRGIDIIGDIPIYVAHDSADVWANPDIFALDE
ETGEVAQMAGVPPDYFSATGQLWGNPVYNWEELQKQDFKWWVQRFEAMLDYVDIIRIDHF
RGFEAYWAVPQGEETAVNGEWIEAPGDAFFETIKQKLGKLPILAEDLGIITPEVETLRDK
YEFPGMKVLQFAFGSDPGNPFLPFNYPRNAVVYTGTHDNDTTIGWYNTATDWEKRNLWLY
LGCVSPEGVHWDLIRLALSAIANQAIIPLQDVLGLGNEARMNYPSTAEGNWEWRYQQDAL
REELGDRLKTLTTLCGRAPQPK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcccagatccagcggcattttgctgcatcccacatcctttcccagccgattt
ggcattggggatttaggcttagaagcttatcgctttattgattttctcaaagagagtgac
caacagtattggcaagttttacctttaggccccactggctacggtaattctccgtatatg
tcatattcagcaatggcgggtaatcccatgctgattagcccagaaaaactcttagatgag
ggtttattagccgaagaagactttgctaatttaccagcatttccagccgaaaaagtgaat
ttcgaccaggttgtggtggtgaagaatgagttgctcaaaaaagcctctgagaattttaaa
actaaagctacaccaattcaacagaaaggatttgaaggtttttgtgacagcaaagcctat
tggctagataattatgccctgtttatggcgatcaaagattctcaatccggtggtagctgg
catacctgggaaccagaactggccaagcgcacaccagaagtattagaggaagcacaaaaa
catctgactacagagattttttattataaattcatccaatatgagttttttcgccagtgg
tcagaactcaaaagttatgcgaacatgcgcggtattgacattattggcgatattcccatt
tatgtagctcatgatagtgctgacgtgtgggcgaatccagacatctttgctttagatgaa
gagacgggagaagtcgcacaaatggcgggcgttccaccagattattttagtgccactggt
caattgtgggggaacccggtttataactgggaagaattgcaaaaacaagactttaaatgg
tgggtgcagcgctttgaggccatgctggattatgtagacataattcgcattgatcacttc
cgaggatttgaagcttattgggctgtaccacagggagaggaaaccgctgtcaatggcgaa
tggattgaagcgcctggggatgctttctttgaaactatcaaacaaaagttgggtaaacta
cctatcttggctgaagatttggggatcattacgccagaggtggaaacgttgcgcgataaa
tacgaatttccggggatgaaagtgttgcaatttgcttttggttctgatcccggtaatcct
tttctacctttcaattacccaagaaatgctgtagtttatacagggactcatgataatgat
acgactattggctggtacaatacagccactgattgggaaaagcgtaacttgtggctttat
ttaggttgtgtcagtccggaaggtgttcactgggatttaattcggttggctttgagtgcg
atcgctaatcaagccattattcccttacaagacgttttgggattagggaacgaagcccgc
atgaattatcccagtactgctgagggtaactgggagtggcgctatcaacaggacgctttg
agagaggaattaggcgatcgcctcaaaactctcaccacactctgtggacgcgccccacag
ccaaaataa

DBGET integrated database retrieval system