KEGG   Calothrix sp. PCC 7507: Cal7507_0860Help
Entry
Cal7507_0860      CDS       T02358                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cal7507_0860
Enzymes [BR:calo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cal7507_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(914511..918146)
Genome map
AA seq 1211 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAFLANSRCGELDIRVFSDRNITTNPEEVAAALKDADVFF
GSLLFDYDQVVWLRDRIAQIPIRLVFESALELMSLTKLGDFAIGDKPKGMPKPVKFILDK
FSNGREEDKLAGYISFLKIGPKLLKYVPVQKVQDLRNWLIIYGYWNAGGSENVASLFWTL
AEKYLDLKIGDIPQPIETPNMGLLHLDYPGFFESPKAYLEWYQNRKDAMNRVSTKPVVGI
LLYRKHVITKQPYIPQLIRRFEEAGLIPLPIFINGVEGHVAVRDWMTTNYEIQQRQQGNI
ETPSLSLEAVKVDAIISTIGFPLVGGPAGSMEAGRQVEVAKRILTAKNVPYFVAAPLLIQ
DIHSWTRQGIGGLQSVVLYALPELDGAIDTVPLGGLVGENIYLVPERVERLIGRVKSWVA
LRQKPASERKIAIILYGFPPGYGAVGTAALLNVPRSLIKFLHALEKAGYHVGDLPEDGEE
LIHLVKAADEESPNTVNARTLEKWLGYLRTSRIEKQWKSLTGSGIKTYGDEFQIGGVQFG
NVWIGVQPPLGIQGDPMRLMFERDLTPHPQYAAFYKWLQNEFQADAIVHFGMHGTVEWLP
GSPLGNTGYSWSDILLGNLPNLYIYAANNPSESMLAKRRGYGVLISHNVPPYGRAGLYKE
LVSLRDLISEYREDTQKNYLLKEGICKKILDTGLESDCPFEDAKKLGITFSPENITMFSN
HAFDDYLVKLYEYLQVLENRLFSSGLHTLGESPSEEGLAGYLEAYFGEESPIDQEEKKLI
TDLLMQSTDELTNLLRGLNGEFIPPAPGGDLLRDGAGVLPTGRNIHALDPYRMPSAAAYE
RGREIAQKIIAQHLQEHRKYPETVAVMLWGLDAIKTKGESLGILLELVGAEPVKEGTGRI
VRYELKPLAEVGHPRIDVLANLSGIFRDSFVNIIELLDDLFLRAADAEEPEDQNFIRKHA
LALKAQGVENVSARLFSNPAGDFGSLVNDRVVDGNWESGEELGNTWQSRNVFSYGRQDKG
QARPEVLNTLLKTSDRIIQEIDSVEYGLTDIQEYYANTGGLKRAAEKQSNKKVTTSFVES
FSKDTTPRNLDDLLRMEYRTKLVNPKWADAMASQGSGGAFEISQRMTALIGWGGTADFKD
DWVYDQAADTYALDPEMAEKLRKANPEAFRNILGRMLEAHGRGFWQADQDKLDKLRQLYE
LTDEELEGVTV
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggatcgtcttgattgctgggtttgaatcattcaacgctgacttgtatagaaaa
gcggcttttttagctaattctcgctgtggtgagttagatattcgggtatttagcgatcgc
aatattaccaccaacccagaggaagtagcagcagcactgaaagacgctgatgttttcttt
ggcagcttactatttgattatgaccaagttgtgtggttacgcgatcgcattgcccaaatc
cccatccggcttgtgtttgagtcagccttggaactgatgagtttaaccaagctgggagat
tttgctattggggacaaaccgaaaggaatgcccaaaccagttaaatttatcttagacaaa
ttcagcaacggacgagaagaagacaaactcgccggttacatcagcttcctaaaaattggc
cccaaactcctcaaatatgtaccagtgcagaaagtgcaagacttacgcaactggctaatt
atctatggttactggaatgcaggcggttcagaaaacgtcgcctcattattctggacatta
gcagaaaaatacttagatttaaaaatcggtgatattccccaacccatcgaaacccccaac
atgggtttactccatctcgactatccaggtttttttgaatcgccaaaagcatatctggaa
tggtatcaaaaccgtaaagacgcgatgaatcgcgtctctacaaaacctgttgtgggaatt
ctgctttatcgcaaacatgtcatcaccaaacaaccatatattcctcaactcatacgccgt
tttgaagaagcggggttaattcccttgcccatctttattaatggtgtcgaaggacacgta
gcagtacgggactggatgacaaccaactacgaaattcaacaacgtcaacagggtaatatt
gaaactccctcactttccctagaagccgttaaagtcgatgctattatttccaccatcggc
ttccccttggtaggtggccctgctggttcaatggaagcagggcgtcaggtagaagtagcc
aaacgcatcctcaccgctaaaaatgtcccctacttcgtcgccgcaccattattaattcaa
gatatccactcttggacacgccaaggtatcggcggcttgcaaagtgtcgtattatatgct
ttaccagaactggatggggcaattgataccgttcccctcggcggcttggtgggcgaaaat
atttatctggttcccgaacgggtagaacggttaattggtagggtgaaaagctgggtagct
ttgcgacaaaaacccgcctcagaacgcaaaatagccattattttgtatggcttcccccct
ggttatggggctgtgggtacagctgcattattaaatgtaccgcgtagtttaattaagttt
ctccatgcgttggaaaaagctggttatcacgtgggggatttaccagaagatggggaagag
ttaattcacttggtgaaagcagcagatgaggagagtcccaatactgtaaacgcccgcaca
ctagaaaaatggttgggatatctccgcacttctcgcattgaaaagcaatggaaatctctg
acaggaagtggaattaaaacttatggtgatgagtttcaaattggtggtgtgcagttcgga
aatgtgtggataggtgtacagccgcctttgggaattcaaggcgatcccatgcggttaatg
tttgagcgagatttaacaccacatcctcaatatgctgctttttataaatggctacaaaat
gaatttcaagctgatgctatagttcattttgggatgcacggtactgtggaatggttgccc
ggttctcctcttggcaatactggctattcttggtcagatattttgttaggaaatttgcct
aatctatatatatatgcagcgaataatccttcagaatcgatgttggcgaaacgtcgcggt
tatggggtgttaatttctcacaatgtcccgccttatggacgtgctggtttgtataaggaa
ttggtatctttgcgggatttgatttcggaatatcgagaagatacgcaaaagaattatctg
ctgaaggaagggatttgtaagaagattttagacactggtttagagtctgattgtccgttt
gaggacgcgaaaaagttgggtattacctttagtccagaaaatatcacaatgtttagtaat
catgcttttgatgattatctggtgaagttgtatgagtatttgcaggtgttagaaaatcgg
ttgttttcttctgggttgcatacattgggagaaagtccgagtgaggagggtttagcgggg
tatttggaggcttattttggagaagaatcaccaatcgaccaagaagagaaaaaactaatt
acagatttgttgatgcaatctactgatgaattaacaaatttactgagaggtttaaatggc
gagtttattccgcctgcgcctgggggtgatttgctgcgggatggggctggtgttttgccg
acggggcggaatattcatgctttagatccttatagaatgccttcagcagcggcttatgaa
aggggacgagaaattgctcaaaaaattattgcccagcatttacaagaacatcgcaaatat
ccggaaactgtggcggtgatgttatggggtttagatgcaattaaaactaagggtgaatcg
ttgggaattcttttggaattagtaggtgctgaacctgtgaaggaggggactgggagaatt
gttcgttatgaattaaagcctttagctgaagtgggacatccccggattgatgtgttagcc
aatttgtctggtatattccgagatagttttgtaaatatcatcgaattattggatgattta
tttctacgggcggctgatgctgaggaaccggaagaccaaaattttatcagaaaacatgct
ttagctttaaaagcccaaggggtagaaaatgtatcggcgagattgttttctaatcctgcg
ggtgattttggttctttggtgaatgatagagttgtggatggtaactgggaatctggcgaa
gagttaggtaatacttggcaaagtcggaacgtgtttagctatggtagacaagataaaggt
caagctagacctgaagttttgaatactttgttgaaaacaagcgatcgcataattcaagaa
atcgattctgtagaatatggtttaaccgatattcaagaatattacgctaatactggtggt
ttgaaaagggcagcagaaaagcaaagcaataagaaggtaactaccagctttgttgagagt
ttctcgaaagatactacaccccgcaatttagacgatttgctgcgaatggaataccgcacg
aagttagtcaatcccaaatgggcggatgcaatggcgagtcaaggttctggcggtgcattt
gaaatttctcaacgcatgacagccttaattggttggggcggtactgctgattttaaagat
gattgggtatacgatcaagccgcagatacttacgctttagatccagaaatggcggagaag
ttacgcaaagcaaatcctgaagctttccgcaatattttaggcagaatgttagaggcacat
gggcgcggtttctggcaagctgatcaagataaattagataagttgcgtcaattatatgag
ttgacagatgaggaattggagggagtgacagtttag

DBGET integrated database retrieval system