KEGG   Calothrix sp. PCC 7507: Cal7507_1044Help
Entry
Cal7507_1044      CDS       T02358                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
calo  Calothrix sp. PCC 7507
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1114125..1114808
Genome map
AA seq 227 aa AA seqDB search
MSTVQLYFAKASTFSQRTRVVLLEKGINFTANEIDLQNKPEGYTQISRYGKVPAIKHGDI
ILYESAIINEYLDEVFPEPPLLPRDPGTKAIARIWIDYANTRFVPAFNKFLRSPDPQEQA
QGGREFLESLLYLEQEGLGKLSHDGPYWFGETLSLVDISFYPWFERLPLLEHFRKFSFPS
ETPRLQKWWNALSDRNSVRQVANPASFYIERFAKILGEPTAVAIAQK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtacaactttatttcgccaaagcctcgaccttttcccaaagaacccgtgtt
gttttgctggaaaaaggcatcaattttactgcgaacgaaattgatctccaaaataaacca
gaaggttatacccaaatttcgcgttatggcaaagttcccgccatcaaacacggggacata
atactttatgagtccgccattatcaacgaatatctggatgaggtgttcccagaaccacct
ctattaccccgcgatcctggcacaaaagcgatcgcccgaatctggatcgattatgccaac
actcgctttgtaccggcgtttaacaaattcctgcgtagtccagatccccaggaacaagca
cagggaggaagggaatttttagaatcgcttttatatcttgagcaagaaggattaggtaag
ctttcccatgatggcccttactggtttggggaaacgctctcattagtggatatcagcttc
tatccctggtttgaacgcctgccgttgctcgaacacttccgcaagttcagcttcccatca
gaaacgccgcgcttacaaaaatggtggaatgctctgagcgatcgcaactcagttcggcaa
gtagcaaatcctgccagcttctatatagaacgattcgccaaaattcttggtgaaccgaca
gctgttgctattgctcaaaaataa

DBGET integrated database retrieval system