KEGG   Calothrix sp. PCC 7507: Cal7507_1044Help
Entry
Cal7507_1044      CDS       T02358                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:calo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1114125..1114808
Genome map
AA seq 227 aa AA seqDB search
MSTVQLYFAKASTFSQRTRVVLLEKGINFTANEIDLQNKPEGYTQISRYGKVPAIKHGDI
ILYESAIINEYLDEVFPEPPLLPRDPGTKAIARIWIDYANTRFVPAFNKFLRSPDPQEQA
QGGREFLESLLYLEQEGLGKLSHDGPYWFGETLSLVDISFYPWFERLPLLEHFRKFSFPS
ETPRLQKWWNALSDRNSVRQVANPASFYIERFAKILGEPTAVAIAQK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtacaactttatttcgccaaagcctcgaccttttcccaaagaacccgtgtt
gttttgctggaaaaaggcatcaattttactgcgaacgaaattgatctccaaaataaacca
gaaggttatacccaaatttcgcgttatggcaaagttcccgccatcaaacacggggacata
atactttatgagtccgccattatcaacgaatatctggatgaggtgttcccagaaccacct
ctattaccccgcgatcctggcacaaaagcgatcgcccgaatctggatcgattatgccaac
actcgctttgtaccggcgtttaacaaattcctgcgtagtccagatccccaggaacaagca
cagggaggaagggaatttttagaatcgcttttatatcttgagcaagaaggattaggtaag
ctttcccatgatggcccttactggtttggggaaacgctctcattagtggatatcagcttc
tatccctggtttgaacgcctgccgttgctcgaacacttccgcaagttcagcttcccatca
gaaacgccgcgcttacaaaaatggtggaatgctctgagcgatcgcaactcagttcggcaa
gtagcaaatcctgccagcttctatatagaacgattcgccaaaattcttggtgaaccgaca
gctgttgctattgctcaaaaataa

DBGET integrated database retrieval system