KEGG   Calothrix sp. PCC 7507: Cal7507_1426Help
Entry
Cal7507_1426      CDS       T02358                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cal7507_1426
Enzymes [BR:calo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cal7507_1426
Transporters [BR:calo02000]
 Other Transporters
  Pores ion channels [TC:1]
   Cal7507_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_6
Motif
Other DBs
NCBI-ProteinID: AFY31892
UniProt: K9PHA6
Position
complement(1539262..1539819)
Genome map
AA seq 185 aa AA seqDB search
MLKLYGGTRSRASIVQWYLEELGVPYEFVKLDMQAGEHRQPDYLTINPIGKVPAIIDGDL
RLWESGAILLYLADKYGKNATSPEERAIAAQWTLFANATLGPGIFGEATREKEMPRLLAP
LNEIFARQPFLLGDEFTVADVAVGSILTYIPIMLKLDLSAYPAVLEYMTRVSERPAFQKS
IGGRS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaactttatggtggcactcgtagccgcgcttcaattgtgcagtggtatttagag
gaattaggagttccctacgaattcgtcaagcttgatatgcaagcaggcgaacatcgccaa
cctgattatctaacaattaatcccataggtaaagtccccgcaattatcgatggggattta
cggctgtgggaatcaggggcaattttgctgtatctcgctgataagtatggcaaaaatgcc
acttccccagaagaacgcgctattgcagcccagtggactttatttgccaatgctaccctc
ggcccaggcatatttggagaagccactagagaaaaggaaatgcctcgtttattagctcct
ttaaatgaaatttttgcacggcaaccttttttgttgggcgatgaattcaccgttgctgat
gtcgcagtcgggtctatcctgacttatatccccatcatgttgaagctagatttgagcgct
tacccagccgtattagaatacatgacgcgggtatccgagcgccccgcatttcaaaaaagc
attggcggacgctcttaa

DBGET integrated database retrieval system