KEGG   Calothrix sp. PCC 7507: Cal7507_1546Help
Entry
Cal7507_1546      CDS       T02358                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cal7507_1546
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cal7507_1546
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cal7507_1546
Enzymes [BR:calo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cal7507_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1659888..1660982)
Genome map
AA seq 364 aa AA seqDB search
MTLSLSVAKSHHQPWPGLIEAYREYLPVSENTPVVTLLEGNTPLIPAPAIAARIGKQVRV
FLKYDGLNPTGSFKDRGMTMAISKAKEDGAKAVICASTGNTSAAAAAYARRGGMSAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDRALEIVCEMAQSYPITLVNSVNPYRLEGQKTA
AFEIVDALGNAPDWLCIPVGNAGNISAYWMGFCQYHQAGKCDRLPKMMGFQAAGAAPLVN
GHPVAHPETLATAIRIGNPASWDKAVAAQSASQGHFHAVTDAEILDAYRLLASSEGIFCE
PASAASVAGLLQVKDQIPAGATVVCVLTGNGLKDPDTAIKHSHSQFKQGIEAEVEAVAEA
MGLS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcctgtctgttgctaaatctcatcaccaaccttggcctgggctgatagaa
gcctatcgtgaatatttgcccgtcagcgaaaacacgccggttgtcaccctgttggaaggt
aatacccctctaattccagcgccagcgatcgccgcacgtattggtaaacaagtccgtgtg
tttttgaaatatgacggtcttaaccccactggtagcttcaaagaccggggaatgacaatg
gcgatttccaaagctaaggaagacggagccaaggcggtaatatgtgcgagtacaggcaat
acctcggcagcagcagcagcttatgctaggcgtggtggtatgagtgcctttgtgctaatt
cccgatggctatgtggctttgggtaagttggcacaggcattgctttatggggctgaggta
ctggcaattaaaggtaattttgaccgcgctctggaaattgtctgcgagatggctcaaagc
tatccgataactttagtgaattcggttaatccctaccgtctagaagggcagaaaacagca
gcatttgaaattgtagatgctttgggtaatgctcccgattggttgtgtatcccagtgggt
aatgcgggaaatatcagtgcatattggatgggattttgtcaatatcatcaagccggaaag
tgcgatcgcttaccaaaaatgatgggtttccaagcagcaggagcagcacctctagttaac
ggacacccagtagcccatcccgaaactttagctacagccattcggattggcaaccccgct
agctgggacaaagccgtcgccgctcaatcagctagtcaaggacattttcatgctgttact
gatgcagaaattctcgatgcttatcgattattggcatcatctgaaggcattttttgtgaa
cctgccagcgcggcttctgtggctggtttgttacaggtaaaagaccaaattcccgcaggc
gcaacagtggtttgtgtcctcaccggcaatggtcttaaagacccagatacagccatcaaa
catagccacagtcaatttaaacaaggcattgaggcggaagtagaagcagtagcggaggct
atgggattatcgtaa

DBGET integrated database retrieval system