KEGG   Calothrix sp. PCC 7507: Cal7507_1645Help
Entry
Cal7507_1645      CDS       T02358                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:calo00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:calo00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1769493..1771895
Genome map
AA seq 800 aa AA seqDB search
MTNQFSPEIPVCTWSRPIGLGWDKPYTVRYASNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHTFQNIPACQFSVFESHGTSSQAYALSTQAPEDGSLAGWKWYPASGGTYHA
LYPRSWFVYENVFQAQLTCEQFSPVWANNYQETSYPVAIFLWKAHNPTDAPITLSIMLTW
ENMVGWFTNALKSPEVRIRDDGSPVYEYQPRLGESQGNYNQLIENSGQVGCFLSQVDRDA
SVAEGDGSWCIATLKHPQIEVFHHTRWNPVGTGEDVWQSFAADGSLPNYQDATPAIENTR
IGGAIAIRFTLQPGQTIEIPFSLAWDFPVTEFAAGVNYYRRYTDFFGRSGENAWAIASTA
LQEYQNWRSQIQRWQKPILEREDLPQWFKMALFNELYDLTSGGTLWSAASKLDPVGQFAV
LECLDYRWYESLDVRLYGSFALLMLFPELEKSVIRAFARAIPHSDAHQRVIGYYYTIGAD
TTTAVRKVPGATPHDLGAPNEHVWEKTNYTCYQDCNLWKDLGSDFVLQVYRDFLLTGADD
VEFLTDCWPAIVETLNYLKTFDQDDDGIPENSGAPDQTFDDWRLQGVSAYCGGLWLAALE
AAIAISNILLNQNLADLGNLALQKSIYETWLAQSRPIYEEKLWNGQYYRLDSKSGSDVVM
ADQLCGQFYARLLGLPDIVASDRALSALQTVYEACFLKFYDGQFGAANGVRPDGSPENPQ
ATHPLEVWTGINFGLAAFLVQMGMQDEALKLTQAVVKQIYDNGLQFRTPEAITTVGTFRA
STYLRAMAIWAIYLGIGHRA
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaattctccccggaaattcctgtttgcacttggagtcgtcctatcggttta
ggttgggataaaccttatactgtccgctacgctagtaatatcgatgatggcccttggcat
ggtatgcctttaggcggctttggtgcaggttgcatcgggcgctcttctcggggagacttt
aatttatggcatattgacggcggtgagcatactttccagaacattcccgcctgtcaattc
agtgtatttgaatctcatggcacttcttcccaagcctacgccttatctactcaagcgcca
gaggatggtagtcttgcagggtggaagtggtatccggcgagtggaggtacttatcatgcc
ttatacccccgtagttggtttgtgtatgaaaatgtgtttcaagcacagttaacttgtgag
cagttttcccctgtttgggcgaataactaccaagaaactagttacccagtggcaattttc
ctgtggaaggcgcataacccaacagatgcaccgattactctcagcatcatgctgacttgg
gaaaatatggtgggttggtttacgaatgcgttgaaatctccagaggtgcggatacgagat
gatggcagtccggtttatgaatatcagccgcgtttgggagaaagtcaaggtaattacaat
cagctaattgaaaattctggacaggttggttgttttttatctcaggttgatagggatgca
tccgtcgctgaaggggatggtagctggtgtattgccacgttgaagcatccccagatagaa
gtatttcatcacacccggtggaatcctgtgggtacaggggaagatgtctggcaaagcttt
gcagcagatggctcgttgcctaattatcaagatgcaactcctgcaatagagaatacacga
ataggtggagcgatcgctatccgtttcactctgcaaccagggcaaactatagaaattccc
ttctctctggcttgggatttcccggtgacagaatttgcagcgggagtgaactattaccgc
agatatacagacttttttggtcggagtggtgaaaatgcttgggcgatcgcatctactgct
ctccaagaatatcaaaattggcgatcgcagatccaacgttggcaaaaaccaattctagaa
cgggaagatttgccacaatggttcaaaatggctctatttaatgagctgtatgacctcact
agcggtggtactctctggagtgcagcgtcaaaacttgatcctgttggtcaatttgcggtt
ttggaatgcctagattaccgctggtatgaaagtctcgatgtgcggttatatggttcattt
gcccttttaatgctgtttccagaattagaaaagtcggtaatccgggcatttgcacgggct
attccccacagtgacgctcatcagcgggtaattggctattactacacaattggcgcagac
acaacaaccgccgttcgcaaagtcccaggtgcaacaccccacgatttaggcgcacccaat
gaacatgtgtgggaaaaaaccaactatacctgctatcaggactgcaatttgtggaaggat
ttaggcagtgattttgtgttgcaggtgtaccgggattttctgctaactggtgctgatgat
gtggaattcctgacagattgctggccggcaattgtggaaaccctcaactatctgaaaacc
tttgatcaagatgatgatggcattcctgagaattccggcgcacctgatcaaacctttgat
gattggcgattgcagggagtgagtgcctattgtgggggtttgtggttggctgctttggag
gcagcgatcgctattagcaatattttattaaatcaaaaccttgctgatttaggtaacttg
gcgttacaaaaatccatctatgaaacttggttagcccaatcccgccccatctatgaagaa
aaactctggaatgggcaatattaccgcttggatagcaagagtggttccgatgtggtgatg
gcggatcagttatgtgggcaattctatgcccgactattgggattaccagatattgtagcg
agcgatcgcgccctttctgccctgcaaactgtttatgaagcttgcttcttgaaattctac
gatggtcaatttggggctgcaaatggcgttcgtcccgatggttcaccagaaaacccgcaa
gcgactcacccgctggaagtctggacaggaatcaactttggactagcagcttttctcgtg
cagatgggaatgcaagatgaagctttgaagttgacgcaagctgtagtaaagcagatttac
gacaacggactacaattccgcacccctgaagccatcaccaccgttggtactttccgcgcc
agtacttacctgcgggcgatggctatttgggcgatttatttaggaatagggcatagggca
tag

DBGET integrated database retrieval system