KEGG   Calothrix sp. PCC 7507: Cal7507_1739Help
Entry
Cal7507_1739      CDS       T02358                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:calo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1883418..1884269)
Genome map
AA seq 283 aa AA seqDB search
MPELPEVETVRRGLNQLTLNREITGGDVLLDRTIAHPFSVGEFIHGIKGSAIATWHRRGK
YLLAELTPSSPSSANGWLGVHLRMTGQLLWLHRDEPLHKHTRVRLFFGDEQELRFVDQRT
FGQMWWVPPNVVVETIITGLGKLAADPFSPEFTVDYLAQKLQNRHRPIKTALLDQSVVAG
LGNIYADEALFKSGILPETLCTNLERSQIERLRIAIIQVLEASIAAGGTTFSNFLNVKGV
NGNYGGVALVYNRTGEPCRVCGNLIQRIKLGGRSSHFCSQCQQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgcctgaagtagaaacagtccggcggggtctaaatcaattgaccctcaat
cgagaaatcacgggtggtgatgtgttgcttgatcgcacgatcgcccacccgttttctgtt
ggtgagtttattcatggaattaaagggagcgccatcgctacttggcatcgtcgcggcaaa
tatctcctcgccgaactcaccccatcctccccctcctctgccaacggctggctaggcgtg
catctccgaatgacaggtcaactactgtggttacatcgagatgaaccattacacaagcac
acgcgggtaagattattttttggggatgaacaggaattgcgttttgttgatcagcgcacc
tttggtcaaatgtggtgggtaccgccaaatgtggtcgtggaaactatcattactggttta
ggtaaactcgcagcagatccattttcaccggaattcactgttgattatttggcgcaaaaa
ctgcaaaatcgccaccgtccaattaagacagcgctgttggatcagtccgtcgtggcgggg
ttaggtaatatctatgccgacgaagcgctgttcaagagtggaattctaccagaaactctc
tgtacaaatttagagcgatcgcaaattgagcggttacgaattgcgattattcaagtatta
gaagccagtattgccgcaggtggcacgacttttagtaattttctcaatgtcaaaggtgtc
aacggtaactatggcggtgtagccctagtctataaccgcactggagaaccctgtagagtt
tgtggcaacttaatacagcgaattaagttaggtggccgttctagtcacttttgttcccag
tgtcagcaataa

DBGET integrated database retrieval system