KEGG   Calothrix sp. PCC 7507: Cal7507_2084Help
Entry
Cal7507_2084      CDS       T02358                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
calo  Calothrix sp. PCC 7507
Brite
Enzymes [BR:calo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cal7507_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2289157..2290323)
Genome map
AA seq 388 aa AA seqDB search
MLSRRLVGRRHALWLSLASLSSIGAIALTKTRYDSHKLQALANLKRDFKVSGIATLRKRA
ATKGLIFGAASSQDILSKDTAFATQFAQECSILVPEGELKWNFLRPTPKKFDFTQSDWLA
EFAKNHNMLFRGHTLVWHDALPAWFKTTVNSGNAEKFLTEHISTVTKHYAGRIHSWDVVN
EAVEPKDGRSDGLKNTPWMQFLGPNYIELAFRVAAQADPQALLVYNDYGLEYDTPEGGAK
RVAVLKLLKSLKSRGTPIHGLGIQSHLSSDDTPFNPHKLRKFLADVASLGLKILITELDV
TDVRLPENSGVRDRIVAGVYEDYLSVVLDEPAVIGVLTWGLSDRYTWNSTYNPRSDSKPV
RPLPLDSNLQRKLAWNAMARAFDKARKR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtaggcgattagtaggtagacgacacgctttatggttaagtttagctagcttg
agcagtattggagcgatcgcactcactaagactagatacgatagtcacaagctccaagcc
cttgctaatctcaaaagagactttaaagtgtctggaatagccactctacgaaagcgcgcc
gctacaaaaggattgatttttggtgcggcgagtagtcaagatatactctcgaaagatact
gcttttgccactcaatttgctcaagaatgcagcattctggttccagaaggtgaactcaag
tggaactttttgcgccctactcccaagaagtttgacttcacccaaagtgattggttagca
gagtttgccaaaaatcacaacatgctgtttcgcgggcatactttagtctggcatgatgct
ttgcctgcgtggtttaagacaacagttaactcagggaatgcggaaaaattcttaacagaa
cacatttcaacagttactaaacactatgcaggtagaatacattcctgggatgtagtaaac
gaggcagttgaaccaaaagatggccgctccgacgggttaaaaaatactccctggatgcag
tttttggggccaaattatatcgaacttgcctttcgggttgccgcgcaagctgatcctcaa
gccttgctagtttataacgactatggtttggagtacgatactcctgaaggtggtgccaaa
agagtagcagttttaaaattgctaaagagtctgaaatctagaggaacaccaattcatgga
ctcggcatccaatctcatttatcgagtgatgataccccattcaatccgcataaactccgg
aaatttctagcggatgttgctagtttaggtctcaaaattctgattaccgaactagatgtc
acagatgtgagattacctgaaaattctggagtacgcgatcgcatagttgctggtgtctac
gaagattatctgtcggttgttctagacgagcctgccgtgattggtgtattaacttggggt
ttgagcgatcgctacacttggaattcaacatataatccccgatccgatagtaaaccagta
cgtcctttgccattggactcaaatctccaacgtaagttggcctggaatgctatggctaga
gcttttgacaaggctagaaaacgttag

DBGET integrated database retrieval system