KEGG   Calothrix sp. PCC 7507: Cal7507_2244Help
Entry
Cal7507_2244      CDS       T02358                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cal7507_2244
Enzymes [BR:calo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cal7507_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2481390..2482328
Genome map
AA seq 312 aa AA seqDB search
MTIIVFGSINIDLVATVPRLPVAGETLLGHNFVQVPGGKGANQAVAVARLGIPTHMVGRV
GTDSFGTELIYNLFNSGVETENVSIDETASSGVAMIAVDDKGENQIIVVPGANGRVNQED
VERLSDLLPNSSALLLQFEIPIAAVVAAAKAAHQAGVQVILDPAPAQSHVPDELYPLVDI
ITPNEVEAGQLVGFSVDGEESAKKAAAVLLQRGVKCAIVKLGAKGVVCAIAKETFFIPPF
PVHAVDTVAAGDAFNGGLAAALDQGLSLHQAVVWGAAAGALAATKPGAQTSLPHKSAFDA
FLREQGVIKDEG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccattatcgtcttcggcagcatcaatatagacttagttgctactgtaccccgctta
ccagttgcaggagaaacactattagggcataactttgttcaagttccaggtgggaaaggt
gcaaatcaagctgtagcagtagcacggttgggaattcccactcatatggtagggcgtgta
ggtacagatagttttgggacagaattaatttacaatctgtttaactctggcgtggagacg
gagaatgtttctatcgacgaaactgccagttctggagtggcgatgatcgctgtcgatgac
aaaggtgaaaatcaaattattgtcgttcctggtgctaatgggcgtgtcaatcaagaagac
gtagagcgattgtctgatttattaccgaatagcagcgcattgcttttacaatttgaaatt
cccattgctgctgtggtggctgctgctaaagctgcacatcaagcaggtgtgcaagtgatt
ctcgaccctgcgccggcacaatctcatgtgccagatgaactttatccattagtagatatc
attacgccgaatgaagtggaagcgggacagttggtgggtttttccgtagatggggaagag
tcagcaaaaaaagcggcagcggttttattgcagcggggcgtgaaatgtgcgatcgttaaa
ctgggcgctaaaggagttgtctgtgcgatcgctaaagaaactttttttatccccccattc
cccgtccatgctgttgacacagtcgctgctggcgacgcttttaatggtggtttagccgca
gcccttgatcaaggactttctctacatcaagcagttgtttggggtgcagcagctggcgcc
ttagccgctacaaaaccaggcgcacaaacttctttaccccataagtcagcttttgatgca
tttctccgggaacaaggcgtaatcaaggatgaaggatga

DBGET integrated database retrieval system