KEGG   Calothrix sp. PCC 7507: Cal7507_2593Help
Entry
Cal7507_2593      CDS       T02358                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:calo01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:calo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2931300..2932118)
Genome map
AA seq 272 aa AA seqDB search
MTIANSTKPQINWVNTPFFIFLHLGALFALVPSNFSWNAVGVALFLYWVTGGLGITLGYH
RLVTHRSFQTPKWLEYVLVFFGTLACQGGPIEWVGTHRMHHLHSDTEKDPHDSNQGFWWS
HMGWLIYNSPTQPEIPRFTKDIVDDPVYQFLQKYFILIQFALAALLLALGGWSFVVWGVF
VRIIWVYHCTWLVNSATHKFGYRTHESGDRSTNCWWVAVLVFGEGWHNNHHAFQYSARHG
LEWWEIDLTWMTIQLLQALGLATNVKLADKKS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgactattgctaactcaaccaaaccgcaaattaactgggttaataccccgtttttcatt
tttttacacctcggtgctttgtttgctttggttcctagtaactttagctggaatgcagtt
ggtgtagctttatttctttactgggtgactggtggtttaggtattaccctgggatatcac
cgtcttgtcactcaccgtagttttcaaactcccaagtggttagagtatgtcctagttttt
ttcgggactctcgcctgtcaaggaggaccgattgagtgggtaggtacacaccgaatgcat
catttgcactcggatactgaaaaagacccccatgattctaatcagggtttctggtggagc
catatgggttggctgatttacaactctcccactcaacctgaaatacctcgtttcactaaa
gacattgtggatgacccagtttatcagtttttacaaaaatatttcattttaatccagttc
gctctggctgcattgctattagccctgggcggctggtcttttgtggtttggggcgtgttt
gttcgcattatctgggtttaccactgcacttggttagtcaacagtgctactcataagttt
ggttatcgcactcatgaatctggcgatcgctccactaactgctggtgggtagctgtttta
gtgttcggtgaaggctggcacaataaccaccatgcttttcaatactcggctcgtcacggc
ttggaatggtgggaaattgatctaacctggatgacaatccaattgttgcaagcactggga
ctagctacaaatgtaaaactagcagataagaaaagctaa

DBGET integrated database retrieval system