KEGG   Calothrix sp. PCC 7507: Cal7507_2982Help
Entry
Cal7507_2982      CDS       T02358                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:calo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3393198..3393869)
Genome map
AA seq 223 aa AA seqDB search
MLTLYHAPISPNSRRVWITLLEKGLEFELVEIKLNGEQFKPEFLAINPFHHIPALVDDGL
NIIESLAILDYLEAKYPTPAMLPTDAKDLAIARMVQLVTVNELLPATTTFLPQILGLPAE
NPEKIEQAKQKISTVMKLFESLLDYRPYFGSEQLTLAEAVAGTVVPWLPTIGISLSDYPK
MEAWCDRLIARPAWQATQTTPEAMAEFKAIVVARMTQPAKTEV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctgacactttatcacgcaccaatttctcctaattcccgccgtgtttggattactcta
ctagaaaaaggacttgagtttgaattagtagaaatcaaattaaatggggagcagtttaaa
cccgaatttttggcaattaatccttttcatcatattccagctttggtagatgacggctta
aatataatcgaatctctggcaattttggactatttagaagcaaagtaccctacgcctgcg
atgttgcctacagatgccaaagatttagcgatcgcccgcatggtacaactagtaacggtg
aatgaacttttgccagctaccacgacatttttgcctcaaatattaggcttaccagcagag
aacccagaaaaaattgagcaggcgaagcagaaaatctctacagtgatgaaattatttgaa
agcctactcgattatcgcccttactttggtagcgaacagctaacactagctgaagcggtt
gcgggaacagttgtaccctggttgccaacaataggtatttccctaagtgattatcccaaa
atggaggcttggtgcgatcgcttaattgcacgtcccgcatggcaagcaacccaaaccaca
ccggaagcgatggcagaatttaaagctatcgtcgtggcaagaatgacccaaccagctaag
actgaagtctga

DBGET integrated database retrieval system