KEGG   Calothrix sp. PCC 7507: Cal7507_3086Help
Entry
Cal7507_3086      CDS       T02358                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal7507_3086
Enzymes [BR:calo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cal7507_3086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3521367..3522629)
Genome map
AA seq 420 aa AA seqDB search
MRYLPKVAIIASLINLYACVSGYSVDPKTLNNQTPVPNVTTPGSGENLSVFLAALPQSTP
NRDLLAESWDSYRRRFIQSDGRVIDFEASDRSTSEGQAYAMLRSVLIDDPETFAKTLKWS
ENNLFRQQNGKRTDSLWAWKWGKKPDGNWGVIDSNFASDGDIDAITALILASRRWNRPEY
LELAKTKLQDLWNLSSAPGYGGKRYLLPGPKAAFIPNESTLYLNPSYLAPYAFRIFAQVD
PAREWLSLVDTSYEILENSTRLSTVGLPSDWVALDIKTGQFQIVPQSSNLQSLYSFDAYR
VWWRLSLDAAWFNSPQARRYLQQSTQHLQKLWTQQSRLPARIDLQGKPLVDYEATSQYAM
FYAAMRLVKPALAQELLLKKLLPQYKQGIWGDDSAYYTQNLAWLGLLPPDSLPIQLIQVN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcggtatctcccaaaagtggcgattattgccagcctgatcaatctctatgcatgtgtt
tctggttattcagtcgatcctaaaacactgaataatcagactcccgtaccaaacgtcact
actcctggtagtggtgaaaatttgtcggtatttttggcggctctaccccaatctacccca
aatcgggacttactagccgaaagctgggacagctaccgacggagatttatccaaagtgat
gggcgggtaattgactttgaagcgagcgatcgctcaactagtgaaggtcaagcctatgcc
atgctgcgttctgtacttattgatgaccccgaaacttttgccaaaactttaaagtggtct
gaaaataatctctttcgacaacagaatggcaaacgcacagacagtctatgggcttggaaa
tggggaaaaaagccagatggtaattggggtgtcatcgatagcaacttcgctagcgatggt
gatatcgatgcgattactgccctgattttggcttcacgccgctggaatcgtcctgaatac
ttggaattggcaaaaacaaaactacaggatttatggaacctttccagcgccccaggatac
ggaggtaagcgctatcttctaccaggaccgaaagcagcatttattcctaatgaatccacc
ctttacctcaatccctcatatctcgcaccttatgcttttcgcatatttgcacaagttgat
cccgcccgtgaatggttgagtttagttgataccagttacgaaatcctggaaaattcgacg
cggctttctaccgttggtttgcctagtgattgggtggctctagatatcaaaactggtcaa
ttccaaatcgtcccccaatcaagcaatcttcagagcttgtatagctttgacgcttatcga
gtttggtggcgtttatcacttgatgccgcctggttcaattcaccacaagcgcggcgttat
ttgcagcaatcgactcagcatctacaaaaattgtggactcaacaatcacgtttaccagca
cggatcgatctccaaggaaaaccattagtagattatgaagccacatctcaatatgccatg
ttctatgctgctatgcggttagtaaaaccagctttagcacaagaactgctgctaaaaaaa
ttactccctcaatacaaacaaggaatatggggtgatgactcagcttattacacccaaaat
ttagcttggttagggttactacctccagactcattgcccattcaactcatacaagttaat
tag

DBGET integrated database retrieval system