KEGG   Calothrix sp. PCC 7507: Cal7507_3086Help
Entry
Cal7507_3086      CDS       T02358                                 

Definition
(GenBank) glycoside hydrolase family 8
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
calo  Calothrix sp. PCC 7507
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3521367..3522629)
Genome map
AA seq 420 aa AA seqDB search
MRYLPKVAIIASLINLYACVSGYSVDPKTLNNQTPVPNVTTPGSGENLSVFLAALPQSTP
NRDLLAESWDSYRRRFIQSDGRVIDFEASDRSTSEGQAYAMLRSVLIDDPETFAKTLKWS
ENNLFRQQNGKRTDSLWAWKWGKKPDGNWGVIDSNFASDGDIDAITALILASRRWNRPEY
LELAKTKLQDLWNLSSAPGYGGKRYLLPGPKAAFIPNESTLYLNPSYLAPYAFRIFAQVD
PAREWLSLVDTSYEILENSTRLSTVGLPSDWVALDIKTGQFQIVPQSSNLQSLYSFDAYR
VWWRLSLDAAWFNSPQARRYLQQSTQHLQKLWTQQSRLPARIDLQGKPLVDYEATSQYAM
FYAAMRLVKPALAQELLLKKLLPQYKQGIWGDDSAYYTQNLAWLGLLPPDSLPIQLIQVN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcggtatctcccaaaagtggcgattattgccagcctgatcaatctctatgcatgtgtt
tctggttattcagtcgatcctaaaacactgaataatcagactcccgtaccaaacgtcact
actcctggtagtggtgaaaatttgtcggtatttttggcggctctaccccaatctacccca
aatcgggacttactagccgaaagctgggacagctaccgacggagatttatccaaagtgat
gggcgggtaattgactttgaagcgagcgatcgctcaactagtgaaggtcaagcctatgcc
atgctgcgttctgtacttattgatgaccccgaaacttttgccaaaactttaaagtggtct
gaaaataatctctttcgacaacagaatggcaaacgcacagacagtctatgggcttggaaa
tggggaaaaaagccagatggtaattggggtgtcatcgatagcaacttcgctagcgatggt
gatatcgatgcgattactgccctgattttggcttcacgccgctggaatcgtcctgaatac
ttggaattggcaaaaacaaaactacaggatttatggaacctttccagcgccccaggatac
ggaggtaagcgctatcttctaccaggaccgaaagcagcatttattcctaatgaatccacc
ctttacctcaatccctcatatctcgcaccttatgcttttcgcatatttgcacaagttgat
cccgcccgtgaatggttgagtttagttgataccagttacgaaatcctggaaaattcgacg
cggctttctaccgttggtttgcctagtgattgggtggctctagatatcaaaactggtcaa
ttccaaatcgtcccccaatcaagcaatcttcagagcttgtatagctttgacgcttatcga
gtttggtggcgtttatcacttgatgccgcctggttcaattcaccacaagcgcggcgttat
ttgcagcaatcgactcagcatctacaaaaattgtggactcaacaatcacgtttaccagca
cggatcgatctccaaggaaaaccattagtagattatgaagccacatctcaatatgccatg
ttctatgctgctatgcggttagtaaaaccagctttagcacaagaactgctgctaaaaaaa
ttactccctcaatacaaacaaggaatatggggtgatgactcagcttattacacccaaaat
ttagcttggttagggttactacctccagactcattgcccattcaactcatacaagttaat
tag

DBGET integrated database retrieval system