KEGG   Calothrix sp. PCC 7507: Cal7507_3099Help
Entry
Cal7507_3099      CDS       T02358                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cal7507_3099
  Amino acid metabolism
   00340 Histidine metabolism
    Cal7507_3099
Enzymes [BR:calo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Cal7507_3099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3544690..3545991
Genome map
AA seq 433 aa AA seqDB search
MLRIITQQADVRAELQRICNRTHDEQVLHKEATVREVLQAVKRQGNKAVLHYTAEFDNQI
LKPEELRVTGSDLDAAYQQVSKELLGAIRLACNQIEAFHRQRVPKSWVHFGDDDVVLGKR
YTPVDCAGLYVPGGRAAYPSTVLMNAIPARVAGVPRVVIATPPGAQKVISPAVLVAAQEA
GVQEIYRVGGAQAIAALAYGTETIPKVNVITGPGNIYVTLAKKLVYGTVGIDSLAGPSEV
LIIADETANAVHVAADLLAQAEHDPMAAAILLTTDAALAKNVQVAVERQLVDHPRRLDTE
KAIAHYGLIVIVESLEAAAELSNEFAPEHLELQIADPWELLPQIRHAGAIFLGKFTPEAV
GDYLAGPNHTLPTSGAARYASALGVETFLKHSSIIQYSKTALQNVAGAIDVLATAEGLPS
HTDSVRRRIQQEE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcattactcagcaggcagacgtcagagcagaactacaacgtatctgcaat
cgtacccatgacgaacaggtgcttcacaaagaagcaacggtgcgagaagtgttgcaagca
gtaaaacgccaaggcaacaaagctgtgttacactacacagctgaatttgataaccaaatc
ctgaagccagaagagctgcgtgtcacaggttcagacctagatgcagcctaccaacaggtg
tcgaaggagttgcttggggcgattaggttagcttgtaaccaaattgaagcgtttcaccgt
cagcgagtcccgaaaagctgggtacactttggcgatgatgatgtggtgttaggtaaacgc
tacaccccggttgactgtgcaggtttatacgtgcctgggggtcgtgctgcctatcctagt
acggtactgatgaatgcaattccagccagggtagctggcgtaccccgtgtagtgattgca
acaccaccaggagcgcaaaaagtaattagccctgcagttttggtagctgcccaagaagcg
ggggtgcaggaaatttatcgcgtcgggggggcacaggcgatcgctgctttagcctacggc
acagaaacaattcctaaagtgaatgtgatcactggccctggcaacatttatgtgactctg
gctaaaaaactggtctatggaactgtgggcattgattccttagcaggaccaagcgaagtg
ctaattattgctgatgaaaccgccaatgctgtacatgttgccgctgacttattagcacaa
gccgaacatgatccaatggcagcagcgattttgttaaccacagatgctgctttggccaag
aacgtgcaggtagcggtggaacgacaattggtagatcatccacgacgactagacacagaa
aaagcgatcgctcactatggcttgatagtaattgtagaatccctggaagcagcagctgaa
ctctctaatgaatttgcccccgaacatctggaattacaaatcgcagatccttgggaatta
ttaccacaaattcgtcatgctggggcaatcttcttgggtaaatttacacctgaagctgta
ggagattatttggcagggcctaaccatactttgccgacttctggtgctgctcgctatgcc
tcagcactaggtgtagaaacctttctgaaacactctagtattatccaatattcaaaaact
gccctgcaaaacgtagctggggctattgacgtactagcaacagcggaaggactaccttcc
cacaccgattcagtacgacgccgaattcagcaagaagagtga

DBGET integrated database retrieval system